P09565 IG2R_HUMAN
Gene name: GIG44
Protein name: Putative insulin-like growth factor 2-associated protein
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O00341 | SLC1A7 | 0.64018 | transport GO:0006810 |
| 2 | Q9NP58 | ABCB6 | 0.61394 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | P07384 | CAPN1 | 0.60286 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 4 | O15400 | STX7 | 0.53067 | cellular component assembly GO:0022607 immune system process GO:0002376 membrane organization GO:0061024 ... |
| 5 | P51157 | RAB28 | 0.52446 | protein transport GO:0015031 signal transduction GO:0007165 transport GO:0006810 |
| 6 | Q9NZF1 | PLAC8 | 0.52284 | biosynthetic process GO:0009058 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 7 | Q6ZWE6 | PLEKHM3 | 0.46761 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 8 | O95841 | ANGPTL1 | 0.45354 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 signal transduction GO:0007165 |
| 9 | Q9ULK4 | MED23 | 0.45105 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | P55075 | FGF8 | 0.4414 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
20 40 60 80 100 AA: MTPGVVHASPPQSQRVPRQAPCEWAIRNIGQKPKEPNCHNCGTHIGLRSKTLRGTPNYLPIRQDTHPPSVIFCLAGVGVPGGTCRPAPCVPRFAALPWAT STMI: DO_DISOPRED3: DDDDDDDDDDD......................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDD.DDDDD..D.DD.............D.............DDDDDDD....................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDD................D............................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[QV]: VVhasppQsQrVprQ
AA: NHPGPGCLSDLRA STMI: DO_DISOPRED3: ............D DO_IUPRED2A: ............. DO_SPOTD: ............D CONSENSUS: ............D CONSENSUS_MOBI: .............