Q9NV23 SAST_HUMAN
Gene name: OLAH
Protein name: S-acyl fatty acid synthase thioesterase, medium chain
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q92851 | CASP10 | 0.85847 |
cell death
GO:0008219 signal transduction GO:0007165 |
2 | Q8TDW0 | LRRC8C | 0.82069 |
cell differentiation
GO:0030154 cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 ... |
3 | Q9NZJ9 | NUDT4 | 0.8176 |
biosynthetic process
GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
4 | A8MYZ0 | MINDY4B | 0.81147 | |
5 | P31269 | HOXA9 | 0.80052 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
6 | Q96GC9 | VMP1 | 0.79673 |
anatomical structure development
GO:0048856 catabolic process GO:0009056 cell adhesion GO:0007155 ... |
7 | Q9Y222 | DMTF1 | 0.74343 |
biosynthetic process
GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 |
8 | O60907 | TBL1X | 0.71958 |
biosynthetic process
GO:0009058 catabolic process GO:0009056 cell-cell signaling GO:0007267 ... |
9 | P49768 | PSEN1 | 0.71884 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
10 | P56880 | CLDN20 | 0.70073 |
cell adhesion
GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
20 40 60 80 100
AA: MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVCALQPVIQDKPFAFFGH
STMI:
DO_DISOPRED3: DDDDDDDDD...........................................................................................
DO_IUPRED2A: DDDDDDDD.......................................................D.DD..DDD............................
DO_SPOTD: DDDDDDDDDDD.........................................................................................
CONSENSUS: DDDDDDDDD...........................................................................................
CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDD..................................DDDDDDDDDDDDDDDDDD........................
RICH_MOBI_[N]: NeNifNclykN
RICH_fLPS_MOBI_[N]: krtrNeNifNclykN
120 140 160 180 200
AA: SMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVL
STMI:
DO_DISOPRED3: ....................................................................................................
DO_IUPRED2A: .......................................DD...........................................................
DO_SPOTD: ....................................................................................................
CONSENSUS: ....................................................................................................
CONSENSUS_MOBI: ..........................................................DDDDDDD...................................
220 240 260
AA: SCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF
STMI:
DO_DISOPRED3: ...............................................................DD
DO_IUPRED2A: .................................................................
DO_SPOTD: ............................................................DDDDD
CONSENSUS: ...............................................................DD
CONSENSUS_MOBI: .................................................................