Q9NZQ0 DJC27_HUMAN
Gene name: DNAJC27
Protein name: DnaJ homolog subfamily C member 27
List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464
- nucleocytoplasmic transport GO:0006913
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q68CZ6 | HAUS3 | 0.83205 |
cell cycle
GO:0007049 cell division GO:0051301 cellular component assembly GO:0022607 ... |
2 | P37173 | TGFBR2 | 0.70711 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
3 | Q9NUN5 | LMBRD1 | 0.65493 |
biological process involved in symbiotic interaction
GO:0044403 small molecule metabolic process GO:0044281 |
4 | Q8WWB3 | DYDC1 | 0.57907 |
cellular protein modification process
GO:0006464 chromosome organization GO:0051276 |
5 | Q86WA8 | LONP2 | 0.56614 |
catabolic process
GO:0009056 protein maturation GO:0051604 protein targeting GO:0006605 ... |
6 | P52429 | DGKE | 0.56047 |
biosynthetic process
GO:0009058 cell-cell signaling GO:0007267 response to stress GO:0006950 ... |
7 | P02708 | CHRNA1 | 0.52504 |
anatomical structure development
GO:0048856 cell junction organization GO:0034330 cell-cell signaling GO:0007267 ... |
8 | Q8IY95 | TMEM192 | 0.51777 | |
9 | Q92973 | TNPO1 | 0.50917 |
biological process involved in symbiotic interaction
GO:0044403 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
10 | O60928 | KCNJ13 | 0.47508 |
transmembrane transport
GO:0055085 transport GO:0006810 |
20 40 60 80 100
AA: MEANMPKRKEPGRSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHVRDREIKVNIFDMAGHPFFYEVRNEFYKDTQGVILVYDVGQ
STMI:
DO_DISOPRED3: DDDDDDDDDD..........................................................................................
DO_IUPRED2A: DDDDDD..............................................................................................
DO_SPOTD: DDDDDDDDDDD.........................................................................................
CONSENSUS: DDDDDDDDDD..........................................................................................
CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200
AA: KDSFDALDAWLAEMKQELGPHGNMENIIFVVCANKIDCTKHRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKRPTTNSSAS
STMI:
DO_DISOPRED3: ..........................................................................................DDDDDDDDDD
DO_IUPRED2A: .............................................................................................DDDDDDD
DO_SPOTD: .........................................................................................DDDDDDDDDDD
CONSENSUS: ..........................................................................................DDDDDDDDDD
CONSENSUS_MOBI: ....................................................................................................
220 240 260
AA: FTKEQADAIRRIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIK
STMI:
DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD...............................................
DO_IUPRED2A: D........................................................................
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDD...............................................
CONSENSUS_MOBI: .........................................................................
RICH_[DI]: DaIrrIrnskDswD