Q9P0M9 RM27_HUMAN
Gene name: MRPL27
Protein name: 39S ribosomal protein L27, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6NVH7 | SWSAP1 | 0.77671 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 |
| 2 | Q7KZF4 | SND1 | 0.73279 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cell cycle GO:0007049 ... |
| 3 | Q9NVE7 | PANK4 | 0.73279 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 4 | Q9BSN7 | TMEM204 | 0.68045 | anatomical structure development GO:0048856 cell differentiation GO:0030154 signal transduction GO:0007165 |
| 5 | Q9UNA3 | A4GNT | 0.68045 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell population proliferation GO:0008283 ... |
| 6 | P61758 | VBP1 | 0.68045 | cellular component assembly GO:0022607 protein folding GO:0006457 protein-containing complex assembly GO:0065003 |
| 7 | P23490 | LORICRIN | 0.66974 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 8 | P02533 | KRT14 | 0.64533 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 9 | P19012 | KRT15 | 0.61175 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 10 | Q9H223 | EHD4 | 0.60861 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 protein-containing complex assembly GO:0065003 ... |
20 40 60 80 100 AA: MASVVLALRTRTAVTSLLSPTPATALAVRYASKKSGGSSKNLGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKCLYALEEGIVRYT STMI: TTTTTTTTTTTTTTTTTTTTTTTTTTTTTT DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD...........D.DDDDDDDDDDDD..................................................... DO_IUPRED2A: ............................DDD.....DDDDDDDDDDDDDD..DDD............................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................... CONSENSUS: DDDDDDDDDDDDDDDDDD.................................................... CONSENSUS_MOBI: DDD................................................................... RICH_[G]: GGssknlGGkssG RICH_[GS]: SGGSSknlGGkSSG
120 140 AA: KEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML STMI: DO_DISOPRED3: ................................................ DO_IUPRED2A: ................................................ DO_SPOTD: ................................................ CONSENSUS: ................................................ CONSENSUS_MOBI: ................................................