Q9P0R6 GSKIP_HUMAN
Gene name: GSKIP
Protein name: GSK3B-interacting protein
List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
- cell-cell signaling GO:0007267
- cellular protein modification process GO:0006464
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q7L945 | ZNF627 | 0.78232 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | Q9UBE0 | SAE1 | 0.77717 | cellular protein modification process GO:0006464 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 3 | Q6B0B8 | TIGD3 | 0.76538 | |
| 4 | Q8IW40 | CCDC103 | 0.73452 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 5 | Q9NX74 | DUS2 | 0.70322 | cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q9P2K6 | KLHL42 | 0.70322 | catabolic process GO:0009056 cell cycle GO:0007049 cell division GO:0051301 ... |
| 7 | P52747 | ZNF143 | 0.70322 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | Q6ZNG0 | ZNF620 | 0.62898 | |
| 9 | Q96J66 | ABCC11 | 0.61974 | transmembrane transport GO:0055085 transport GO:0006810 |
| 10 | P40763 | STAT3 | 0.58961 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
20 40 60 80 100 AA: METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRLEAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVETKERNRYCLELTEAGLKVVGYAFDQVDDHLQ STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: .D..D.....D...............DD........................................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[E]: EEgsElngfE RICH_[M]: MetdcnpMelssM RICH_[EF]: FEEgsElngF RICH_[EG]: ElssmsGfEEGsElnGfEG
120 AA: TPYHETVYSLLDTLSPAYREAFGNALLQRLEALKRDGQS STMI: DO_DISOPRED3: ...................................DDDD DO_IUPRED2A: ....................................... DO_SPOTD: ...................................DDDD CONSENSUS: ...................................DDDD CONSENSUS_MOBI: .......................................