Q9P1D8 YP008_HUMAN

Gene name: PRO2289
Protein name: Putative uncharacterized protein PRO2289

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P50479 PDLIM4 0.6657 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
cytoskeleton organization GO:0007010
2 Q96AG3 SLC25A46 0.66343 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
3 Q96EP9 SLC10A4 0.66018 transport GO:0006810
4 Q9HBB8 CDHR5 0.64233 cell adhesion GO:0007155
cell differentiation GO:0030154
cellular component assembly GO:0022607
5 Q8TDC3 BRSK1 0.64037 anatomical structure development GO:0048856
cell cycle GO:0007049
cell differentiation GO:0030154
...
6 Q14195 DPYSL3 0.63935 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
7 P23246 SFPQ 0.63725 biosynthetic process GO:0009058
cell cycle GO:0007049
cell death GO:0008219
...
8 P79522 PRR3 0.63672
9 Q12852 MAP3K12 0.63506 biosynthetic process GO:0009058
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
10 Q58A44 PCOTH 0.62692

                                           20                  40                  60                
AA:                      MMITRGWEGWGRRGARGAGTGTGLGGPGTPESSVTPPEFPLPPATRITPNFPNTLDPAISRSSS
STMI:                                                                                    
DO_DISOPRED3:            ..................D.........................................DDDD
DO_IUPRED2A:             ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PT]:                                  TgTglggPgTPessvTPP                           
RICH_[RW]:                   RgWegWgRRgaR                                                
RICH_[G]:                     GweGwGrrGarGaGtGtGlGGpG                                    
RICH_[P]:                                          PgtPessvtPPefPlPPatritPnfPntldP       
RICH_[R]:                    RgwegwgRRgaR                                                
RICH_[T]:                                   TgTglggpgTpessvT                             
RICH_[FP]:                                                   PeFPlPPatritPnFP            
RICH_[GP]:                                 GtGtGlGGPGtPessvtPPefPlP                      
RICH_[GR]:                   RGweGwGRRGaRGaGtGtG                                         
RICH_[GT]:                               GaGTGTGlGGpGTpessvT                             
RICH_[GW]:                    GWeGWGrrGarGaGtGtGlGG                                      
RICH_[NT]:                                                           TriTpNfpNT          
RICH_fLPS_[G]:                GweGwGrrGarGaGtGtGlGGpG                                    
RICH_MOBI_[PT]:                                      TPessvTPPefPlPPaTriT                
RICH_MOBI_[RW]:              RgWegWgRRgaR                                                
RICH_MOBI_[G]:                GweGwGrrGarGaGtGtGlGGpG                                    
RICH_MOBI_[P]:                                     PgtPessvtPPefPlPPatritPnfPntldP       
RICH_MOBI_[R]:               RgwegwgRRgaR                                                
RICH_MOBI_[T]:                              TgTglggpgTpessvT                             
RICH_MOBI_[FP]:                                             PPeFPlPPatritPnFPntldP       
RICH_MOBI_[FT]:                                            TppeFplppaTriTpnFpnT          
RICH_MOBI_[GM]:          MMitrGweGwGrrGarGaG                                             
RICH_MOBI_[GP]:                                GlGGPGtPessvtPPefPlP                      
RICH_MOBI_[GR]:              RGweGwGRRGaRGaGtGtG                                         
RICH_MOBI_[GT]:                          GaGTGTGlGGpGTpessvT                             
RICH_MOBI_[GW]:               GWeGWGrrGarGaGtGtGlGG                                      
RICH_MOBI_[IP]:                                                 PlPPatrItPnfPntldPaI     
RICH_MOBI_[MR]:          MMitRgwegwgRRgaR                                                
RICH_MOBI_[MW]:          MMitrgWegW                                                      
RICH_MOBI_[NT]:                                                      TriTpNfpNT          
RICH_fLPS_MOBI_[G]:           GweGwGrrGarGaGtGtGlGGpG