Q9P1G2 RBAS1_HUMAN

Gene name: RBM12B-AS1
Protein name: Putative uncharacterized protein encoded by RBM12B-AS1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UGN4 CD300A 0.51501 cell adhesion GO:0007155
cell population proliferation GO:0008283
cellular protein modification process GO:0006464
...
2 Q9P0P0 RNF181 0.51281 cellular protein modification process GO:0006464
3 O15072 ADAMTS3 0.50539 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
4 Q86WI3 NLRC5 0.49732 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
immune system process GO:0002376
...
5 P0CW23 AKAIN1 0.49643
6 Q9UQF0 ERVW-1 0.49392 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
7 Q9Y6M1 IGF2BP2 0.4711 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
8 Q58DX5 NAALADL2 0.45256
9 O75603 GCM2 0.43517 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
10 Q8N8J6 ZNF615 0.43237 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MAQDFSQHPQTGIIRRHRFYSPKPLSTTPRGQSFLLSRQAKVATWDPMLSPDFQPKSAFKLTWTAQPPCLSVTPSQGQTFHPNSPEGELPPDLTENTCPS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDD..............................................................................................
DO_IUPRED2A:             DDDDDDDDD.DDDD.DDDDDDDDDD....DDDDD.DDD.......DDD.......DDD.............DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDD......DD.................................DDDDD..DDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDD....DDDD.........................................DDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[HI]:                      HpqtgIIrrH                                                                                   
RICH_[HQ]:                 QdfsQHpQtgiirrH                                                                                   
RICH_[IQ]:                 QdfsQhpQtgII                                                                                      
RICH_MOBI_[R]:                         RRhRfyspkplsttpR                                                                      
RICH_MOBI_[FI]:              FsqhpqtgIIrrhrF                                                                                 
RICH_MOBI_[HI]:                 HpqtgIIrrH                                                                                   
RICH_MOBI_[HQ]:            QdfsQHpQtgiirrH                                                                                   
RICH_MOBI_[IQ]:            QdfsQhpQtgII                                                                                      
RICH_MOBI_[IR]:                      IIRRhRfyspkplsttpR                                                                      

                                           
AA:                      QA
STMI:                      
DO_DISOPRED3:            DD
DO_IUPRED2A:             DD
DO_SPOTD:                DD
CONSENSUS:               DD
CONSENSUS_MOBI:          DD