Q9P299 COPZ2_HUMAN
Gene name: COPZ2
Protein name: Coatomer subunit zeta-2
List of terms from Generic GO subset, which this protein is a part of:
- protein transport GO:0015031
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6ZVX9 | PAQR9 | 0.94367 | |
| 2 | Q8N9F0 | NAT8L | 0.88169 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 3 | Q9H0C5 | BTBD1 | 0.87524 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular protein modification process GO:0006464 |
| 4 | A6NJT0 | UNCX | 0.87387 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 |
| 5 | Q96RK1 | CITED4 | 0.87381 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q9BX70 | BTBD2 | 0.8686 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 7 | Q4ZIN3 | TMEM259 | 0.86815 | catabolic process GO:0009056 cell death GO:0008219 response to stress GO:0006950 |
| 8 | Q9P217 | ZSWIM5 | 0.86704 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 |
| 9 | P53350 | PLK1 | 0.84688 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell cycle GO:0007049 ... |
| 10 | P63027 | VAMP2 | 0.83921 | cell-cell signaling GO:0007267 cellular component assembly GO:0022607 immune system process GO:0002376 ... |
20 40 60 80 100 AA: MQRPEAWPRPHPGEGAAAAQAGGPAPPARAGEPSGLRLQEPSLYTIKAVFILDNDGRRLLAKYYDDTFPSMKEQMVFEKNVFNKTSRTESEIAFFGGMTI STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D............................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. RICH_[AG]: AwprphpGeGAAAAqAGGpAppArAGepsG RICH_[AP]: PeAwPrPhPgegAAAAqAggPAPPArAgeP RICH_[A]: AwprphpgegAAAAqAggpAppArA RICH_[P]: PrPhPgegaaaaqaggPaPP RICH_[GP]: PeawPrPhPGeGaaaaqaGGPaPParaG RICH_fLPS_[A]: hpgegAAAAqAggpAppArA RICH_MOBI_[AG]: AwprphpGeGAAAAqAGGpAppArAG RICH_MOBI_[AP]: PrPhPgegAAAAqAggPAPPArAgeP RICH_MOBI_[A]: AwprphpgegAAAAqAggpAppArA RICH_MOBI_[P]: PrPhPgegaaaaqaggPaPP RICH_MOBI_[GP]: PrPhPGeGaaaaqaGGPaPP RICH_fLPS_MOBI_[A]: hpgegAAAAqAggpAppArA
120 140 160 180 200 AA: VYKNSIDLFLYVVGSSYENELMLMSVLTCLFESLNHMLRKNVEKRWLLENMDGAFLVLDEIVDGGVILESDPQQVIQKVNFRADDGGLTEQSVAQVLQSA STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: KEQIKWSLLK STMI: DO_DISOPRED3: .......... DO_IUPRED2A: .......... DO_SPOTD: .......... CONSENSUS: .......... CONSENSUS_MOBI: ..........