P63027 VAMP2_HUMAN

Gene name: VAMP2
Protein name: Vesicle-associated membrane protein 2

List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- immune system process GO:0002376
- membrane organization GO:0061024
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- transmembrane transport GO:0055085
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5TA89 HES5 0.88489 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
2 Q8N9F0 NAT8L 0.88232 biosynthetic process GO:0009058
small molecule metabolic process GO:0044281
3 Q9H0C5 BTBD1 0.88145 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular protein modification process GO:0006464
4 Q96GE9 DMAC1 0.88022 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
5 Q8TF64 GIPC3 0.87666
6 Q96RK1 CITED4 0.86574 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
7 Q9P299 COPZ2 0.83921 protein transport GO:0015031
transport GO:0006810
vesicle-mediated transport GO:0016192
8 Q6ZVX9 PAQR9 0.83612
9 O00303 EIF3F 0.82592 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cellular component assembly GO:0022607
...
10 Q9Y644 RFNG 0.82083 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILG
STMI:                                                                                                                  MMMMMM
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....D...............................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................D...................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................      
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDD....................................DDDDDDD...........................      
RICH_[AG]:                         AApAGeGGppA                                                                               
RICH_[AP]:                 AtAAtAPPAAPAgeggPPAPPP                                                                            
RICH_[A]:                  AtAAtAppAApAgeggppA                                                                               
RICH_[P]:                        PPaaPageggPPaPPP                                                                            
RICH_[GP]:                           PaGeGGPPaPPP                                                                            
RICH_[NP]:                                  PaPPPNltsN                                                                       
RICH_fLPS_[P]:               aataPPaaPageggPPaPPP                                                                            
RICH_fLPS_[A]:           msAtAAtAppAApAgeggppA                                                                               
RICH_fLPS_[PA]:              AAtAPPAAPAgeggPPAPPP                                                                            
RICH_fLPS_[AP]:              AAtAPPAAPAgeggPPAPPP                                                                            
RICH_MOBI_[AG]:                    AApAGeGGppA                                                                               
RICH_MOBI_[AP]:            AtAAtAPPAAPAgeggPPAPPP                                                                            
RICH_MOBI_[A]:             AtAAtAppAApAgeggppA                                                                               
RICH_MOBI_[P]:                   PPaaPageggPPaPPP                                                                            
RICH_MOBI_[GP]:                      PaGeGGPPaPPP                                                                            
RICH_fLPS_MOBI_[A]:      msAtAAtAppAApAgeggppA                                                                               

                             
AA:                      VICAIILIIIIVYFST
STMI:                    MMMMMMMMMMMMMM  
DO_DISOPRED3:            ........D......D
DO_IUPRED2A:             ................
DO_SPOTD:                DD..DDDDDDDDDDDD
CONSENSUS:                             .D
CONSENSUS_MOBI:                        ..