Q9UHA3 RLP24_HUMAN
Gene name: RSL24D1
Protein name: Probable ribosome biogenesis protein RLP24
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- protein-containing complex assembly GO:0065003
- ribonucleoprotein complex assembly GO:0022618
- ribosome biogenesis GO:0042254
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P32455 | GBP1 | 0.79972 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 2 | Q86W25 | NLRP13 | 0.74536 | |
| 3 | O00410 | IPO5 | 0.72749 | biological process involved in symbiotic interaction GO:0044403 cell cycle GO:0007049 cellular protein modification process GO:0006464 ... |
| 4 | O60518 | RANBP6 | 0.71551 | nucleocytoplasmic transport GO:0006913 protein transport GO:0015031 transport GO:0006810 |
| 5 | Q8N8N0 | RNF152 | 0.69099 | catabolic process GO:0009056 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 6 | Q96PP8 | GBP5 | 0.66603 | cellular component assembly GO:0022607 immune system process GO:0002376 protein-containing complex assembly GO:0065003 ... |
| 7 | Q8TAV5 | C11orf45 | 0.5933 | |
| 8 | Q96I23 | PYURF | 0.5933 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 9 | P12814 | ACTN1 | 0.58383 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 10 | Q8WW22 | DNAJA4 | 0.58269 | cellular component assembly GO:0022607 protein folding GO:0006457 response to stress GO:0006950 |
20 40 60 80 100 AA: MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIK STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ..........................................DD..D...DD................................................ DO_SPOTD: ...........................................................DDDDDDDDDDD....DDDD...................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 AA: QKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQEDVDMEDAP STMI: DO_DISOPRED3: ..........................................DD..DDDDDDDDDDDDDDDDD DO_IUPRED2A: .........D.........D.................D......DD..DDDDDDDDDDDDDDD DO_SPOTD: ..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...................D.................D....DDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ............................................................... RICH_[Q]: QleekmvQQlQ RICH_[DM]: MvqqlqeDvDMeD RICH_[DQ]: QQlQeDvDmeD RICH_[EQ]: QlEEkmvQQlQEdvdmE RICH_[MQ]: MvQQlQedvdM