Q9UHD4 CIDEB_HUMAN
Gene name: CIDEB
Protein name: Cell death activator CIDE-B
List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
- protein maturation GO:0051604
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q53F39 | MPPE1 | 0.90213 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 transport GO:0006810 ... |
| 2 | O14638 | ENPP3 | 0.8974 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell population proliferation GO:0008283 ... |
| 3 | P50391 | NPY4R | 0.88492 | signal transduction GO:0007165 |
| 4 | Q9H720 | CWH43 | 0.81373 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 5 | Q9HD23 | MRS2 | 0.73849 | small molecule metabolic process GO:0044281 transmembrane transport GO:0055085 transport GO:0006810 |
| 6 | P00387 | CYB5R3 | 0.7313 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 circulatory system process GO:0003013 ... |
| 7 | P42785 | PRCP | 0.725 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 circulatory system process GO:0003013 ... |
| 8 | Q9UI14 | RABAC1 | 0.70711 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 9 | Q92604 | LPGAT1 | 0.70711 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 10 | Q8NH81 | OR10G6 | 0.69048 |
20 40 60 80 100 AA: MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLM STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... DO_IUPRED2A: ..........................D...........DD............................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDD.................................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDD........D......................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[L]: LsaLnpsdLL
120 140 160 180 200 AA: VLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTL STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ..................DD................................................................................ DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: RHAVEGAEQWQQKGRLHSY STMI: DO_DISOPRED3: ........DDDDDDDDDDD DO_IUPRED2A: ................... DO_SPOTD: ........DDDDDDDDDDD CONSENSUS: ........DDDDDDDDDDD CONSENSUS_MOBI: ...................