Q9UI14 PRAF1_HUMAN
Gene name: RABAC1
Protein name: Prenylated Rab acceptor protein 1
List of terms from Generic GO subset, which this protein is a part of:
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UHD4 | CIDEB | 0.70711 | cell death GO:0008219 protein maturation GO:0051604 response to stress GO:0006950 ... |
| 2 | Q9UI12 | ATP6V1H | 0.70711 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 homeostatic process GO:0042592 ... |
| 3 | Q53F39 | MPPE1 | 0.63791 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 transport GO:0006810 ... |
| 4 | O14638 | ENPP3 | 0.63456 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell population proliferation GO:0008283 ... |
| 5 | P50391 | NPY4R | 0.62573 | signal transduction GO:0007165 |
| 6 | Q9H720 | CWH43 | 0.5754 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 7 | Q8WXQ3 | LINC01599 | 0.555 | |
| 8 | Q9BX46 | RBM24 | 0.52509 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | Q9HD23 | MRS2 | 0.52219 | small molecule metabolic process GO:0044281 transmembrane transport GO:0055085 transport GO:0006810 |
| 10 | P00387 | CYB5R3 | 0.51711 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 circulatory system process GO:0003013 ... |
20 40 60 80 100 AA: MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRPRNLGELCQRLVRNVEYYQSNYVFVFLGLILYCVVTSPMLLVAL STMI: MMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... DO_IUPRED2A: DDDDD....D.......................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................. CONSENSUS_MOBI: .............................................................................. RICH_[AQ]: AAQkdQQkdA RICH_[L]: LsgttLLpkL
120 140 160 180 AA: AVFFGACYILYLRTLESKLVLFGREVSPAHQYALAGGISFPFFWLAGAGSAVFWVLGATLVVIGSHAAFHQIEAVDGEELQMEPV STMI: MMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ..................................................D.........................DDDDDDDDD DO_IUPRED2A: ..................................................................................... DO_SPOTD: ...........................................................................DDDDDDDDDD CONSENSUS: ................... ...........DDDDDDDDD CONSENSUS_MOBI: ................... ....................