Q9UHV9 PFD2_HUMAN

Gene name: PFDN2
Protein name: Prefoldin subunit 2

List of terms from Generic GO subset, which this protein is a part of:
- cytoskeleton organization GO:0007010
- protein folding GO:0006457

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q86XW9 NME9 0.74162 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
homeostatic process GO:0042592
...
2 P48066 SLC6A11 0.68116 anatomical structure development GO:0048856
transport GO:0006810
3 P50991 CCT4 0.67858 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
...
4 P55884 EIF3B 0.67662 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cellular component assembly GO:0022607
...
5 Q96NT1 NAP1L5 0.67457 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
6 Q9BX73 TM2D2 0.66911
7 A0A0J9YX94 PNMA6F 0.66909
8 Q9NR33 POLE4 0.6655 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
9 Q9H7X3 ZNF696 0.66029 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
10 Q8IWF6 DENND6A 0.65853 cell adhesion GO:0007155

                                           20                  40                  60                  80                 100
AA:                      MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKI
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDD................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDD.D.....................DDDDDD...........D..............................D...........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDD................................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDD................................................................................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AG]:                AensGrAGkssGsGAGkGA                                                                                
RICH_[G]:                     GraGkssGsGaGkG                                                                                 
RICH_[GS]:                   SGraGkSSGS                                                                                      
RICH_fLPS_[G]:               sGraGkssGsGaGkG                                                                                 

                                          120                 140      
AA:                      IETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS
STMI:                                                                          
DO_DISOPRED3:            ..............................DDDDDDDDDDDDDDDDDDD.....
DO_IUPRED2A:             ...........DD.D...DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......
DO_SPOTD:                ..........................DDDDDDDDDDDDDDDDDDDDDDDD....
CONSENSUS:               ..........................DDDDDDDDDDDDDDDDDDDDDDD.....
CONSENSUS_MOBI:          .......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AE]:                                           EdEkpAAkEnsEgAgAkA        
RICH_[A]:                                                 AAkensegAgAkAssA     
RICH_MOBI_[AE]:                                      EdEkpAAkEnsEgAgAkA        
RICH_MOBI_[AG]:                                                  GAGAkAssAG    
RICH_MOBI_[AV]:                                                     AkAssAgVlV 
RICH_MOBI_[A]:                                            AAkensegAgAkAssA