Q9ULX9 MAFF_HUMAN

Gene name: MAFF
Protein name: Transcription factor MafF

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- embryo development GO:0009790
- reproduction GO:0000003
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A2IDD5 CCDC78 0.78864 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
2 Q96L92 SNX27 0.73017 immune system process GO:0002376
protein transport GO:0015031
signal transduction GO:0007165
...
3 Q9NVR0 KLHL11 0.67889 cellular protein modification process GO:0006464
4 Q9BXM7 PINK1 0.67756 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 P62136 PPP1CA 0.67444 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
6 P48546 GIPR 0.66516 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
generation of precursor metabolites and energy GO:0006091
...
7 Q03052 POU3F1 0.64733 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 F2Z3F1 C5orf67 0.63663
9 Q8N1Y9 n/a 0.63432
10 Q96QC0 PPP1R10 0.63282 cell cycle GO:0007049
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MSVDPLSSKALKIKRELSENTPHLSDEALMGLSVRELNRHLRGLSAEEVTRLKQRRRTLKNRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAM
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDD................................................DDD..................................
DO_IUPRED2A:             .D........DDDDDDDD.....DDD.DDD.................D...DD.DDD.....................D.DD.DDDDDDDDDD.......
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDD...............................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDD..................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120                 140                 160                
AA:                      RLELDALRGKCEALQGFARSVAAARGPATLVAPASVITIVKSTPGSGSGPAHGPDPAHGPASCS
STMI:                                                                                    
DO_DISOPRED3:            .....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ........................................DDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ...................DDDDDDDDDDDDDDDDD....DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .....................DDDDDDDDDDDDDDD....DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ........................................DDDDDDDDDDDDDDDDDDDDDDDD
RICH_[A]:                                     AAArgpAtlvApA                              
RICH_[G]:                                                            GsGsGpahGpdpahG     
RICH_[GH]:                                                           GsGsGpaHGpdpaHG     
RICH_[GP]:                                                          PGsGsGPahGPdPahGP    
RICH_fLPS_[A]:                                AAArgpAtlvApAsv                            
RICH_MOBI_[G]:                                                       GsGsGpahGpdpahG     
RICH_MOBI_[GH]:                                                      GsGsGpaHGpdpaHG