Q9BYN0 SRXN1_HUMAN
Gene name: SRXN1
Protein name: Sulfiredoxin-1
List of terms from Generic GO subset, which this protein is a part of:
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q53HC5 | KLHL26 | 0.98828 | |
| 2 | Q5JPI9 | EEF1AKMT2 | 0.95736 | cellular protein modification process GO:0006464 |
| 3 | P16455 | MGMT | 0.93609 | cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 4 | Q96A46 | SLC25A28 | 0.92659 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | Q8N1B3 | CCNQ | 0.91836 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q15005 | SPCS2 | 0.89818 | cellular nitrogen compound metabolic process GO:0034641 protein maturation GO:0051604 protein targeting GO:0006605 ... |
| 7 | Q96CM4 | NXNL1 | 0.89132 | homeostatic process GO:0042592 |
| 8 | Q8TDH9 | BLOC1S5 | 0.89071 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cytoskeleton-dependent intracellular transport GO:0030705 ... |
| 9 | Q9Y5Y6 | ST14 | 0.89037 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 10 | Q8N9U9 | SPANXA2-OT1 | 0.88974 | cell cycle GO:0007049 cell death GO:0008219 reproduction GO:0000003 |
20 40 60 80 100 AA: MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCH STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... DO_IUPRED2A: ........DDDDDDDDDDDDDDDDDDDDDDDDD..............................DD.DDDD.............................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDD.................................................................................... RICH_[AG]: GlrAGGtlGrAGAGrGApeGpG RICH_[G]: GlraGGtlGraGaGrGapeGpGpsGGaqGG RICH_fLPS_[G]: GlraGGtlGraGaGrGapeGpGpsGGaqGG RICH_MOBI_[AG]: AGGtlGrAGA RICH_MOBI_[G]: GlraGGtlGraGaG RICH_fLPS_MOBI_[G]: mGlraGGtlGraGaG
120 AA: RYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ STMI: DO_DISOPRED3: ..................................... DO_IUPRED2A: ..................................... DO_SPOTD: ..................................D.D CONSENSUS: ..................................... CONSENSUS_MOBI: .....................................