Q9Y2Y8 PRG3_HUMAN

Gene name: PRG3
Protein name: Proteoglycan 3

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- immune system process GO:0002376
- small molecule metabolic process GO:0044281
- translation GO:0006412
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8NBP7 PCSK9 0.82064 anatomical structure development GO:0048856
catabolic process GO:0009056
cell death GO:0008219
...
2 P19113 HDC 0.65928 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
3 Q9H790 EXO5 0.65453 cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
response to stress GO:0006950
4 P42892 ECE1 0.62978 anatomical structure development GO:0048856
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
5 Q9NZZ3 CHMP5 0.6218 biological process involved in symbiotic interaction GO:0044403
cell cycle GO:0007049
cell division GO:0051301
...
6 P35606 COPB2 0.62169 protein transport GO:0015031
transport GO:0006810
vesicle-mediated transport GO:0016192
7 Q99633 PRPF18 0.6157 catabolic process GO:0009056
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
8 P51861 CDR1 0.59927
9 O75558 STX11 0.57229 cell-cell signaling GO:0007267
membrane organization GO:0061024
protein transport GO:0015031
...
10 Q4KMQ2 ANO6 0.5718 anatomical structure development GO:0048856
cell death GO:0008219
cellular component assembly GO:0022607
...

                                           20                  40                  60                  80                 100
AA:                      MQCLLLLPFLLLGTVSALHLENDAPHLESLETQADLGQDLDSSKEQERDLALTEEVIQAEGEEVKASACQDNFEDEEAMESDPAALDKDFQCPREEDIVE
STMI:                    SSSSSSSSSSSSSSSSS                                                                                   
DO_DISOPRED3:            DDDDDDDDDDDDD.D..DDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDDD..............................
DO_IUPRED2A:             ......................DDDDDDDDDDDDDDDDDDDDDDDD.D..DDDDD........................DD...................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D.DD......
CONSENSUS:                                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDDD.........DD...................
CONSENSUS_MOBI:                           ...................................................................................
RICH_[D]:                                      DaphlesletqaDlgqDlD                                                           
RICH_[E]:                                                            EqErdlaltEEviqaEgE                                      
RICH_[DL]:                                     DaphLesLetqaDLgqDLD                                                           
RICH_[DQ]:                                               QaDlgQDlDsskeQ                                                      
RICH_[EL]:                                                  LgqdLdsskEqErdLaLtEE                                             
RICH_[HL]:                                LHLendapHL                                                                         

                                          120                 140                 160                 180                 200
AA:                      VQGSPRCKICRYLLVRTPKTFAEAQNVCSRCYGGNLVSIHDFNFNYRIQCCTSTVNQAQVWIGGNLRGWFLWKRFCWTDGSHWNFAYWSPGQPGNGQGSC
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          220               
AA:                      VALCTKGGYWRRAQCDKQLPFVCSF
STMI:                                             
DO_DISOPRED3:            .........................
DO_IUPRED2A:             .........................
DO_SPOTD:                .........................
CONSENSUS:               .........................
CONSENSUS_MOBI:          .........................