Q9NZZ3 CHMP5_HUMAN

Gene name: CHMP5
Protein name: Charged multivesicular body protein 5

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- cell cycle GO:0007049
- cell division GO:0051301
- cellular component assembly GO:0022607
- chromosome organization GO:0051276
- chromosome segregation GO:0007059
- cytoskeleton organization GO:0007010
- membrane organization GO:0061024
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- protein transport GO:0015031
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P51861 CDR1 0.75641
2 P35606 COPB2 0.71556 protein transport GO:0015031
transport GO:0006810
vesicle-mediated transport GO:0016192
3 Q8NBP7 PCSK9 0.67932 anatomical structure development GO:0048856
catabolic process GO:0009056
cell death GO:0008219
...
4 P32302 CXCR5 0.64602 anatomical structure development GO:0048856
cell cycle GO:0007049
cell division GO:0051301
...
5 Q8WXF3 RLN3 0.63344 signal transduction GO:0007165
6 O14662 STX16 0.62988 membrane organization GO:0061024
protein transport GO:0015031
transport GO:0006810
...
7 O95751 LDOC1 0.62522 anatomical structure development GO:0048856
cell population proliferation GO:0008283
reproduction GO:0000003
...
8 O43633 CHMP2A 0.62427 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cell cycle GO:0007049
...
9 Q9Y2Y8 PRG3 0.6218 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
immune system process GO:0002376
...
10 Q4KMQ2 ANO6 0.61714 anatomical structure development GO:0048856
cell death GO:0008219
cellular component assembly GO:0022607
...

                                           20                  40                  60                  80                 100
AA:                      MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLK
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDD.....................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDD.DDDDDDDDDD........................D...DDDDDD.DDDDD...........D..DDDDDDDDDD....DDD..D.D
DO_SPOTD:                DDDDDDDDDDDDDDDDD.......................................................................D..DDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDD...........................................................................DDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDD...............................................................................

                                          120                 140                 160                 180                 200
AA:                      DTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTDT
STMI:                                                                                                                        
DO_DISOPRED3:            .....................................................................................DDDDDDDDDDDDDDD
DO_IUPRED2A:             ..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDD.DD............D.D...D.DDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ......................................DDDDDDDDDDDD........................................DDDDDDDDD.
RICH_[AD]:                                                                                  DAlgDellADeDssylDeAAsApA         
RICH_[AL]:                                                                                   ALgdeLLAdedssyLdeAAsA           
RICH_[D]:                                                                          DeDDleaelDalgDellaDeDssylD                
RICH_[E]:                                                                        EldEddlEaE                                  
RICH_[L]:                                                                         LdeddLeaeLdaLgdeLL                         
RICH_[DE]:                                                                       ElDEDDlEaElDalgDEllaDED                     
RICH_[DL]:                                                               LsrsygtpeLDeDDLeaeLDaLgDeLLaDeD                     
RICH_[DQ]:                                              QDQleDmmeDaneiQ                                                      
RICH_[DV]:                                                                                                              VptDt
RICH_[EL]:                                                               LsrsygtpELdEddLEaEL                                 
RICH_[MQ]:                                              QdQledMMedaneiQ                                                      
RICH_fLPS_[D]:                                                                    lDeDDleaelDalgDellaDeD                     

                          
AA:                      KNKDGVLVDEFGLPQIPAS
STMI:                                       
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDD.......DD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .................DD
RICH_[DV]:               knkDgVlVD