A6NNB3 IFM5_HUMAN
Gene name: IFITM5
Protein name: Interferon-induced transmembrane protein 5
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- embryo development GO:0009790
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P61964 | WDR5 | 0.89622 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 2 | Q86U28 | ISCA2 | 0.86729 | cellular component assembly GO:0022607 protein maturation GO:0051604 small molecule metabolic process GO:0044281 |
| 3 | Q9UNW8 | GPR132 | 0.8582 | cell cycle GO:0007049 mitotic cell cycle GO:0000278 signal transduction GO:0007165 |
| 4 | O43586 | PSTPIP1 | 0.82298 | cell adhesion GO:0007155 immune system process GO:0002376 response to stress GO:0006950 ... |
| 5 | P61647 | ST8SIA6 | 0.79961 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 6 | Q9NZN1 | IL1RAPL1 | 0.78614 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 7 | O95319 | CELF2 | 0.75157 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 circulatory system process GO:0003013 ... |
| 8 | Q6UXZ3 | CD300LD | 0.74072 | immune system process GO:0002376 |
| 9 | Q9NZU1 | FLRT1 | 0.73673 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 10 | Q9NQ25 | SLAMF7 | 0.70711 | cell adhesion GO:0007155 immune system process GO:0002376 response to stress GO:0006950 |
20 40 60 80 100 AA: MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYSIKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLL STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ DO_IUPRED2A: DDDDDDDDDDDDD.DDD....DDDDD.......................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........ ............................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDD............... ............................. RICH_[AT]: TAypredTrApTpskAgAhT RICH_[T]: TaypredTrapTpskagahT
120 AA: LGLVVTGALHLARLAKDSAAFFSTKFDDADYD STMI: MMMMMMM DO_DISOPRED3: ........................D.DDDDDD DO_IUPRED2A: ................................ DO_SPOTD: ..............DDDDDDDDDDDDDDDDDD CONSENSUS: .................DDDDDDDD CONSENSUS_MOBI: .........................