Q9Y3P8 SIT1_HUMAN

Gene name: SIT1
Protein name: Signaling threshold-regulating transmembrane adapter 1

List of terms from Generic GO subset, which this protein is a part of:
- homeostatic process GO:0042592
- immune system process GO:0002376
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y2S7 POLDIP2 0.63814 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
2 Q9Y5Z4 HEBP2 0.63814 cell death GO:0008219
immune system process GO:0002376
membrane organization GO:0061024
...
3 O14493 CLDN4 0.6062 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell junction organization GO:0034330
...
4 Q96PK6 RBM14 0.57235 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular component assembly GO:0022607
...
5 Q7Z4R8 C6orf120 0.55003 cell death GO:0008219
immune system process GO:0002376
transport GO:0006810
...
6 Q8N653 LZTR1 0.54114 anatomical structure development GO:0048856
cellular protein modification process GO:0006464
signal transduction GO:0007165
7 Q9C029 TRIM7 0.5204 cellular protein modification process GO:0006464
8 Q6DKI7 PVRIG 0.51804 immune system process GO:0002376
signal transduction GO:0007165
9 P55058 PLTP 0.5146 biosynthetic process GO:0009058
reproduction GO:0000003
small molecule metabolic process GO:0044281
...
10 Q96QD5 DEPDC7 0.51374 signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MNQADPRLRAVCLWTLTSAAMSRGDNCTDLLALGIPSITQAWGLWVLLGAVTLLFLISLAAHLSQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGR
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSS                MMMMMMMMMMMMMMMMMMMMM                                       
DO_DISOPRED3:            DDDDDDDDDDDDDDDDD.........................................................DDDDDD....................
DO_IUPRED2A:             ...................................................................DDDDDDDDDDDDDDDDD.............D.D
DO_SPOTD:                DDDDDDD...............................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                       ................                     .........DDDDDDDDDDDDDD.............D.D
CONSENSUS_MOBI:                                  ................                     .......................................

                                          120                 140                 160                 180    
AA:                      LSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS
STMI:                                                                                                                    
DO_DISOPRED3:            ...DDDDDDDDDDDDDDDD................................................................D..DDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDD............D..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...DDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDD............DDDDDDDDDDD.........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDD...............DDDDDDDDDDD.........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................
RICH_[AY]:                                                                                   YAsvcAqtrrArAsfpdqAY        
RICH_[A]:                                                                                     AsvcAqtrrArAsfpdqAyAnsqpAA 
RICH_MOBI_[GP]:                                           PPqGriPGPG