O14493 CLD4_HUMAN

Gene name: CLDN4
Protein name: Claudin-4

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
- cell junction organization GO:0034330
- cell morphogenesis GO:0000902
- cellular component assembly GO:0022607
- homeostatic process GO:0042592
- reproduction GO:0000003
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6DD88 ATL3 0.75812 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
2 Q8N4F7 RNF175 0.75808 catabolic process GO:0009056
response to stress GO:0006950
signal transduction GO:0007165
3 A6NMB1 SIGLEC16 0.75692 cell adhesion GO:0007155
immune system process GO:0002376
response to stress GO:0006950
4 Q7RTP0 NIPA1 0.75617 transmembrane transport GO:0055085
transport GO:0006810
5 Q96S52 PIGS 0.75562 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
6 Q9HCM9 TRIM39 0.75433 catabolic process GO:0009056
cell cycle GO:0007049
cell death GO:0008219
...
7 Q96FN4 CPNE2 0.75284
8 Q9UFG5 C19orf25 0.75284
9 P0DMW5 SMIM10L2B 0.75202
10 Q9NUP9 LIN7C 0.74931 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
protein transport GO:0015031
...

                                           20                  40                  60                  80                 100
AA:                      MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVV
STMI:                           MMMMMMMMMMMMMMMMMMMMM                                                     MMMMMMMMMMMMMMMMMMM
DO_DISOPRED3:            DDD....DD...........................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDD.................................................................................................
CONSENSUS:               DDD....                     .....................................................                   
CONSENSUS_MOBI:          .......                     .....................................................                   

                                          120                 140                 160                 180                 200
AA:                      GGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAA
STMI:                    MM               MMMMMMMMMMMMMMMMMMMMM                      MMMMMMMMMMMMMMMMMMMMM                   
DO_DISOPRED3:            ..........................................................................................DDDDDDDDDD
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ........................................................................................DDDDDDDDDDDD
CONSENSUS:                 ...............                     ......................                     .........DDDDDDDDDD
CONSENSUS_MOBI:            ...............                     ......................                     ...................
RICH_[AY]:                                                                                                           YsAkYsAA
RICH_[A]:                                                                                                              AkysAA
RICH_fLPS_[A]:                                                                                                     kpysAkysAA

                                    
AA:                      RSAAASNYV
STMI:                             
DO_DISOPRED3:            DDDDDDDDD
DO_IUPRED2A:             .........
DO_SPOTD:                DDDDDDDDD
CONSENSUS:               DDDDDDDDD
CONSENSUS_MOBI:          .........
RICH_[AY]:               rsAAAsnY 
RICH_[A]:                rsAAA    
RICH_fLPS_[A]:           rsAAA