Q9Y5S9 RBM8A_HUMAN

Gene name: RBM8A
Protein name: RNA-binding protein 8A

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
- nucleobase-containing compound catabolic process GO:0034655
- nucleocytoplasmic transport GO:0006913
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P14616 INSRR 0.68658 anatomical structure development GO:0048856
cellular protein modification process GO:0006464
cytoskeleton organization GO:0007010
...
2 Q96JM7 L3MBTL3 0.68289 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
3 Q15910 EZH2 0.67572 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
4 Q8N535 LINC00471 0.67147
5 Q9BS91 SLC35A5 0.64714 transport GO:0006810
6 Q8IX12 CCAR1 0.6471 biosynthetic process GO:0009058
cell cycle GO:0007049
cell death GO:0008219
...
7 Q8NCS7 SLC44A5 0.64519 biosynthetic process GO:0009058
transmembrane transport GO:0055085
transport GO:0006810
8 Q9BWW8 APOL6 0.63098 transport GO:0006810
9 Q8WVC0 LEO1 0.63098 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
10 Q92620 DHX38 0.62719 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
nucleocytoplasmic transport GO:0006913
...

                                           20                  40                  60                  80                 100
AA:                      MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIK
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................
DO_IUPRED2A:             .DDD....DDDDDDDDDDDDDDDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................DDDDDD........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................
RICH_[D]:                  DvlDlheaggeDfamDeDgD                              DyDsveqDgD                                      
RICH_[K]:                                          KlKeKaKKrK                                                                
RICH_[R]:                                                  RkgRgfgseegsRaRmR                                                 
RICH_[DE]:                    DlhEaggEDfamDEDgDE                   EEgsrarmrEDyDsvEqDgDE                                     
RICH_[DK]:                            DfamDeDgDesihKlKeKaK                                                                   
RICH_[ER]:                                                         EEgsRaRmRE                                                
RICH_[GK]:                                         KlKeKaKKrKGrGfGseeG                                                       
RICH_[GR]:                                                 RkGRGfGseeGsRaRmR                                                 
RICH_[KR]:                                             KaKKRKgRgfgseegsRaR                                                   
RICH_MOBI_[D]:             DvlDlheaggeDfamDeDgD                              DyDsveqDgD                                      
RICH_MOBI_[K]:                                     KlKeKaKKrK                                                                
RICH_MOBI_[R]:                                             RkgRgfgseegsRaRmR                                                 
RICH_MOBI_[DE]:               DlhEaggEDfamDEDgDE                   EEgsrarmrEDyDsvEqDgDE                                     
RICH_MOBI_[DK]:                       DfamDeDgDesihKlKeKaK                                                                   
RICH_MOBI_[DM]:          MaDvlDlheaggeDfaMDeD                                                                                
RICH_MOBI_[GK]:                                    KlKeKaKKrKGrGfGseeG                                                       
RICH_MOBI_[GR]:                                            RkGRGfGseeGsRaRmR                                                 
RICH_MOBI_[KR]:                                        KaKKRKgRgfgseegsRaR                                                   
RICH_fLPS_MOBI_[K]:                      mdedgdesihKlKeKaKKrK                                                                

                                          120                 140                 160      
AA:                      NIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
STMI:                                                                                              
DO_DISOPRED3:            .....................................................DDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .............................DDDDDDDD...................DDDDDDDDDDDDDDDDDD
DO_SPOTD:                .....................................................DDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .....................................................DDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .........................................................DDDDDDDDDDDDDDDDD
RICH_[R]:                                                                          RRggRRRsRspdRRRR
RICH_fLPS_[R]:                                                                 pkgkRRggRRRsRspdRRRR
RICH_MOBI_[R]:                                                                     RRggRRRsRspdRRRR