Q9Y675 SNURF_HUMAN

Gene name: SNURF
Protein name: SNRPN upstream reading frame protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A2RRD8 ZNF320 0.98058 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 Q75N90 FBN3 0.83205 anatomical structure development GO:0048856
3 P59095 STARD6 0.83205 transport GO:0006810
4 P0DN25 C1GALT1C1L 0.74052 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
5 Q9H7R0 ZNF442 0.72217 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
6 O00339 MATN2 0.70314 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
7 P05111 INHA 0.66742 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
8 P15515 HTN1 0.61656 anatomical structure development GO:0048856
immune system process GO:0002376
response to stress GO:0006950
9 Q13103 SPP2 0.60582 anatomical structure development GO:0048856
cellular protein modification process GO:0006464
transport GO:0006810
...
10 Q96GM1 PLPPR2 0.58486 signal transduction GO:0007165

                                           20                  40                  60         
AA:                      MERARDRLHLRRTTEQHVPEVEVQVKRRRTASLSNQECQLYPRRSQQQQVPVVDFQAELRQAFLAETPRGG
STMI:                                                                                           
DO_DISOPRED3:            DDD..................................................................DD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDD.D....DDDDDDDDD.D.......D...........D.DDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDD..........DDDD.D..............................DDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDD..........D....D...............................DDDDDD
CONSENSUS_MOBI:          .......................................................................
RICH_[R]:                  RaRdRlhlRR                                                           
RICH_[HR]:                 RaRdRlHlRRtteqH