Q9Y675 SNURF_HUMAN
Gene name: SNURF
Protein name: SNRPN upstream reading frame protein
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A2RRD8 | ZNF320 | 0.98058 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | Q75N90 | FBN3 | 0.83205 | anatomical structure development GO:0048856 |
| 3 | P59095 | STARD6 | 0.83205 | transport GO:0006810 |
| 4 | P0DN25 | C1GALT1C1L | 0.74052 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 5 | Q9H7R0 | ZNF442 | 0.72217 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | O00339 | MATN2 | 0.70314 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 7 | P05111 | INHA | 0.66742 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 8 | P15515 | HTN1 | 0.61656 | anatomical structure development GO:0048856 immune system process GO:0002376 response to stress GO:0006950 |
| 9 | Q13103 | SPP2 | 0.60582 | anatomical structure development GO:0048856 cellular protein modification process GO:0006464 transport GO:0006810 ... |
| 10 | Q96GM1 | PLPPR2 | 0.58486 | signal transduction GO:0007165 |
20 40 60 AA: MERARDRLHLRRTTEQHVPEVEVQVKRRRTASLSNQECQLYPRRSQQQQVPVVDFQAELRQAFLAETPRGG STMI: DO_DISOPRED3: DDD..................................................................DD DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDD.D....DDDDDDDDD.D.......D...........D.DDDDDD DO_SPOTD: DDDDDDDDDDDDDDDDDD..........DDDD.D..............................DDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDDD..........D....D...............................DDDDDD CONSENSUS_MOBI: ....................................................................... RICH_[R]: RaRdRlhlRR RICH_[HR]: RaRdRlHlRRtteqH