P15515 HIS1_HUMAN

Gene name: HTN1
Protein name: Histatin-1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- immune system process GO:0002376
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P0DN25 C1GALT1C1L 0.88466 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
2 Q9P0M4 IL17C 0.75651 cell-cell signaling GO:0007267
response to stress GO:0006950
signal transduction GO:0007165
3 P05154 SERPINA5 0.69062 anatomical structure development GO:0048856
membrane organization GO:0061024
reproduction GO:0000003
...
4 Q8IW03 SIAH3 0.65218 anatomical structure development GO:0048856
catabolic process GO:0009056
protein targeting GO:0006605
...
5 Q9NP94 SLC39A2 0.64279 transmembrane transport GO:0055085
transport GO:0006810
6 A2RRD8 ZNF320 0.61873 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
7 Q9Y675 SNURF 0.61656
8 Q92901 RPL3L 0.61199 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
9 P55287 CDH11 0.61068 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
10 Q14CZ7 FASTKD3 0.60134 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular component assembly GO:0022607
...

                                           20                  40   
AA:                      MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
STMI:                    SSSSSSSSSSSSSSSSSSS                                      
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........D
DO_IUPRED2A:             .............................DDD.........................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                  DDDDDDDDDDDDDDDDDDDDDDDDDD...........D
CONSENSUS_MOBI:                             ......................................
RICH_[F]:                                                FhekhhshreFpF            
RICH_[H]:                                     HekrHHgyrrkfHekHHsH                 
RICH_[R]:                                        RhhgyRRkfhekhhshR                
RICH_[FH]:                                               FHekHHsHreFpF            
RICH_[HR]:                                    HekRHHgyRRkfHekHHsHR                
RICH_fLPS_[H]:                               sHekrHHgyrrkfHekHHsH