Q9Y680 FKBP7_HUMAN
Gene name: FKBP7
Protein name: Peptidyl-prolyl cis-trans isomerase FKBP7
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6UXK5 | LRRN1 | 0.83617 | anatomical structure development GO:0048856 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 2 | Q16549 | PCSK7 | 0.72597 | cellular nitrogen compound metabolic process GO:0034641 protein maturation GO:0051604 |
| 3 | O94927 | HAUS5 | 0.70711 | cell cycle GO:0007049 cell division GO:0051301 cellular component assembly GO:0022607 ... |
| 4 | Q9Y2U9 | KLHDC2 | 0.70711 | |
| 5 | Q8TE02 | ELP5 | 0.67255 | cellular nitrogen compound metabolic process GO:0034641 |
| 6 | A3KMH1 | VWA8 | 0.64318 | |
| 7 | Q9BXS9 | SLC26A6 | 0.64122 | anatomical structure development GO:0048856 cell differentiation GO:0030154 developmental maturation GO:0021700 ... |
| 8 | Q9UHC6 | CNTNAP2 | 0.63591 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 9 | O95721 | SNAP29 | 0.62278 | catabolic process GO:0009056 cell-cell signaling GO:0007267 cellular component assembly GO:0022607 ... |
| 10 | P56715 | RP1 | 0.61057 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
20 40 60 80 100 AA: MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAM STMI: SSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: ................................DDD................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS: DDD.......................................................................... CONSENSUS_MOBI: .............................................................................
120 140 160 180 200 AA: TDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKK STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .......................D.............................D..............................DD.............. DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ...................................................................................................D
220 AA: NDHDGDGFISPKEYNVYQHDEL STMI: DO_DISOPRED3: .....................D DO_IUPRED2A: .........DD........... DO_SPOTD: .................DDDDD CONSENSUS: .....................D CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[D]: DhDgDgfispkeynvyqhD RICH_MOBI_[DY]: DhDgDgfispkeYnvYqhD