Q9Y691 KCMB2_HUMAN
Gene name: KCNMB2
Protein name: Calcium-activated potassium channel subunit beta-2
List of terms from Generic GO subset, which this protein is a part of:
- circulatory system process GO:0003013
- nervous system process GO:0050877
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8NGW6 | OR6K6 | 0.70711 | signal transduction GO:0007165 |
| 2 | P54762 | EPHB1 | 0.68232 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 3 | Q86YE8 | ZNF573 | 0.64018 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | Q9NR97 | TLR8 | 0.6247 | cellular protein modification process GO:0006464 immune system process GO:0002376 response to stress GO:0006950 ... |
| 5 | Q9ULM6 | CNOT6 | 0.58124 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell cycle GO:0007049 ... |
| 6 | Q9NX36 | DNAJC28 | 0.57735 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 transport GO:0006810 ... |
| 7 | Q8NCR3 | MFI | 0.51215 | anatomical structure development GO:0048856 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 8 | Q8NE65 | ZNF738 | 0.50484 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
| 9 | Q8TEB9 | RHBDD1 | 0.49918 | catabolic process GO:0009056 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 10 | Q8IWA5 | SLC44A2 | 0.49693 | biosynthetic process GO:0009058 immune system process GO:0002376 signal transduction GO:0007165 ... |
20 40 60 80 100 AA: MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIMMYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFS STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D....DDDDDD.D................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDD..................... ................................. CONSENSUS_MOBI: .............................................. ................................. RICH_[Y]: YrhdekrniY
120 140 160 180 200 AA: CGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSL STMI: MMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .............................................................................................. CONSENSUS_MOBI: ..............................................................................................
220 AA: FWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR STMI: MMMMMMMMMMMMMMM DO_DISOPRED3: .................................DD DO_IUPRED2A: ................................... DO_SPOTD: ...............................DDDD CONSENSUS: ..................DD CONSENSUS_MOBI: ....................