Q8NE65 ZN738_HUMAN
Gene name: ZNF738
Protein name: Protein ZNF738
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NR97 | TLR8 | 0.80814 | cellular protein modification process GO:0006464 immune system process GO:0002376 response to stress GO:0006950 ... |
| 2 | P54762 | EPHB1 | 0.8058 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 3 | P52597 | HNRNPF | 0.74508 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 signal transduction GO:0007165 |
| 4 | Q8IWA5 | SLC44A2 | 0.67849 | biosynthetic process GO:0009058 immune system process GO:0002376 signal transduction GO:0007165 ... |
| 5 | Q5T7M9 | DIPK1A | 0.63105 | |
| 6 | P17509 | HOXB6 | 0.63039 | anatomical structure development GO:0048856 embryo development GO:0009790 homeostatic process GO:0042592 ... |
| 7 | O15155 | BET1 | 0.60567 | cellular component assembly GO:0022607 membrane organization GO:0061024 protein transport GO:0015031 ... |
| 8 | Q8TEB9 | RHBDD1 | 0.5944 | catabolic process GO:0009056 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 9 | O15551 | CLDN3 | 0.58898 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 10 | Q9UEU0 | VTI1B | 0.58898 | membrane organization GO:0061024 protein targeting GO:0006605 protein transport GO:0015031 ... |
20 40 60 80 100 AA: MDDLRYGVYPVKGASGYPGAERNLLEYSYFEKGPLTFRDVVIEFSQEEWQCLDTAQQDLYRKVMLENFRNLVFLGIDVSKPDLITCLEQGKDPWNMKRHS STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ DO_IUPRED2A: .................................................................................................DD. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[Y]: YgvYpvkgasgY RICH_[GY]: YGvYpvkGasGYpG RICH_fLPS_[Y]: dlrYgvYpvkgasgY
120 AA: MVATPPESGVLKFPTIIILLSRCFFQSVNICFIYLEP STMI: DO_DISOPRED3: ....................................D DO_IUPRED2A: ..................................... DO_SPOTD: ...................................DD CONSENSUS: ....................................D CONSENSUS_MOBI: .....................................