Q9Y696 CLIC4_HUMAN
Gene name: CLIC4
Protein name: Chloride intracellular channel protein 4
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- cytoskeleton organization GO:0007010
- growth GO:0040007
- homeostatic process GO:0042592
- reproduction GO:0000003
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8IUS5 | EPHX4 | 0.78087 | small molecule metabolic process GO:0044281 |
| 2 | P27169 | PON1 | 0.66895 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 transport GO:0006810 |
| 3 | Q96ES7 | SGF29 | 0.63976 | cellular protein modification process GO:0006464 chromosome organization GO:0051276 |
| 4 | P04629 | NTRK1 | 0.58124 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | O60783 | MRPS14 | 0.48809 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 6 | Q16696 | CYP2A13 | 0.35755 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 7 | P11509 | CYP2A6 | 0.35186 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 8 | Q8NFM4 | ADCY4 | 0.31757 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 9 | P52732 | KIF11 | 0.27296 | cell cycle GO:0007049 cell division GO:0051301 cellular component assembly GO:0022607 ... |
| 10 | Q6J9G0 | STYK1 | 0.27037 |
20 40 60 80 100 AA: MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLC STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDD...................................................................................... DO_IUPRED2A: ................................................................DD.................................. DO_SPOTD: DDDDDDDDDDDDDD...................................................................................... CONSENSUS: DDDDDDDDDDDDDD...................... ........................................... CONSENSUS_MOBI: DDDDD............................... ........................................... RICH_[LM]: MaLsMpLngL
120 140 160 180 200 AA: PPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKV STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .........DD...............................................DD.D...DD................................. DO_SPOTD: ...............................................................DDDDDDD.............................. CONSENSUS: .................................................................DD................................. CONSENSUS_MOBI: ..............................................................DDDDDDDD..............................
220 240 AA: VAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK STMI: DO_DISOPRED3: ....................................................D DO_IUPRED2A: ..................................................... DO_SPOTD: ....................................................D CONSENSUS: ....................................................D CONSENSUS_MOBI: .....................................................