O60783 RT14_HUMAN

Gene name: MRPS14
Protein name: 28S ribosomal protein S14, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P16442 ABO 0.49884 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cellular protein modification process GO:0006464
2 P57054 PIGP 0.48809 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
3 Q9Y696 CLIC4 0.48809 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
4 Q49B96 COX19 0.43386 cellular component assembly GO:0022607
homeostatic process GO:0042592
protein-containing complex assembly GO:0065003
5 Q52LJ0 FAM98B 0.39779 cell population proliferation GO:0008283
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
6 Q8IUS5 EPHX4 0.38114 small molecule metabolic process GO:0044281
7 P27169 PON1 0.32651 catabolic process GO:0009056
small molecule metabolic process GO:0044281
transport GO:0006810
8 Q96ES7 SGF29 0.31226 cellular protein modification process GO:0006464
chromosome organization GO:0051276
9 A2RUQ5 C17orf102 0.30323
10 Q9BW27 NUP85 0.28759 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGV
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDD.....................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDD.DDDDDDDDDDD..............................................................................
CONSENSUS:               DDDDDDDDDDDDDDD.....................................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................................................
RICH_[FL]:                  FmLgsLLrtF                                                                                       
RICH_[LM]:               MaafMLgsLL                                                                                          
RICH_MOBI_[F]:              FmlgsllrtF                                                                                       
RICH_MOBI_[FL]:             FmLgsLLrtF                                                                                       
RICH_MOBI_[FM]:          MaaFMlgsllrtFkqM                                                                                    
RICH_MOBI_[LM]:          MaafMLgsLLrtfkqM                                                                                    

                                          120            
AA:                      KRRWRLSRIVFRHLADHGQLSGIQRATW
STMI:                                                
DO_DISOPRED3:            ............................
DO_IUPRED2A:             ............................
DO_SPOTD:                ............................
CONSENSUS:               ............................
CONSENSUS_MOBI:          ............................