O60783 RT14_HUMAN
Gene name: MRPS14
Protein name: 28S ribosomal protein S14, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | P16442 | ABO | 0.49884 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular protein modification process GO:0006464 |
2 | P57054 | PIGP | 0.48809 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
3 | Q9Y696 | CLIC4 | 0.48809 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
4 | Q49B96 | COX19 | 0.43386 | cellular component assembly GO:0022607 homeostatic process GO:0042592 protein-containing complex assembly GO:0065003 |
5 | Q52LJ0 | FAM98B | 0.39779 | cell population proliferation GO:0008283 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
6 | Q8IUS5 | EPHX4 | 0.38114 | small molecule metabolic process GO:0044281 |
7 | P27169 | PON1 | 0.32651 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 transport GO:0006810 |
8 | Q96ES7 | SGF29 | 0.31226 | cellular protein modification process GO:0006464 chromosome organization GO:0051276 |
9 | A2RUQ5 | C17orf102 | 0.30323 | |
10 | Q9BW27 | NUP85 | 0.28759 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGV STMI: DO_DISOPRED3: DDDDDDDDDDDDDDD..................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDD.DDDDDDDDDDD.............................................................................. CONSENSUS: DDDDDDDDDDDDDDD..................................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... RICH_[FL]: FmLgsLLrtF RICH_[LM]: MaafMLgsLL RICH_MOBI_[F]: FmlgsllrtF RICH_MOBI_[FL]: FmLgsLLrtF RICH_MOBI_[FM]: MaaFMlgsllrtFkqM RICH_MOBI_[LM]: MaafMLgsLLrtfkqM
120 AA: KRRWRLSRIVFRHLADHGQLSGIQRATW STMI: DO_DISOPRED3: ............................ DO_IUPRED2A: ............................ DO_SPOTD: ............................ CONSENSUS: ............................ CONSENSUS_MOBI: ............................