Citrus Sinensis ID: 000135


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810------1820------1830------1840------1850------1860------1870------1880------1890------1900------1910------1920------1930------1940------1950------1960------1970------1980------1990------2000------2010------2020------2030------2040------2050------2060------2070------2080------209
MDGDDKGIVLACAISGTLFAVLGSASFSILWAVNWRPWRLYSWIFARKWPNVLQGGQLGIICRFLALSAWMVVISPVAVLIMWGSWLIVILGRDIIGLAIIMAGTALLLAFYSIMLWWRTQWQSSRAVAVLLLLAVALLCAYELSAVYVTAGSHASDRYSPSGFFFGVSAIALAINMLFICRMVFNGNGLDVDEYVRRAYKFAYPDGIEMGPLACLPEPPDPNELYPRQSSKASHLGLLYAGSLVVLFVYSILYGLTAMEARWLGAVTSAAVIILDWNMGACLYGFQLLQSRVAALFVAGTSRVFLICFGVHYWYLGHCISYAVVASVLLGAAVSRHLSVTNPLAARRDALQSTVIRLREGFRRKEQNSSSSSSEGCGSSVKRSSSAEAAHLGNIIEASSRSAAQCSVDVTTWNNGVLCRTASSHEGINSDKSMDSGRPSLALCSSSCRSVVQEPEAGTSFVDKNYDQNNSLVVCNSSGLDSQGCDSSTSTSANQQILDLNLALAFQERLNDPRITSMLKKRAREGDRELTSLLQDKGLDPNFAMMLKEKSLDPTILALLQRSSLDADRDHGDNTDVAVIDSNSVDNVMPNQISLSEELRLRGLEKWLQMSRFVLHKAAGTPERAWVLFSFIFILETISVAIFRPKTIRIINARHQQFEFGFAVLLLSPVVCSIMAFLRSFRAEEMAMTSKPRKYGFIAWLLSTSVGLLLSFLSKSSLLLGLSLTVPLMVACLSFAIPIWIRNGYQFKVPQVQCAATPGGNDQPPGKKEGIVLVICITVFTGSVLALGAIVSAKPLEDLGYKGWTGEPNSFASPYASSVYLGWLMASAIALVVTGVLPIVSWFSTYRFSLSSAICVGIFAAVLVAFCGASYLEVVKSREDQVPTKGDFLAALLPLVCIPALLSLCSGLLKWKDDDWKLSRGVYVFITIGLVLLLGAISAVIVVITPWTIGVAFLLLLLLIVLAIGVIHHWASNNFYLTRTQMFFVCFLAFLLGLAAFLVGWFDDKPFVGASVGYFTFLFLLAGRALTVLLSPPIVVYSPRVLPVYVYDAHADCGKNVSVAFLVLYGVALAIEGWGVVASLKIYPPFAGAAVSAITLVVAFGFAVSRPCLTLKTMEDAVHFLSKDTVVQAISRSATKTRNALSGTYSAPQRSASSTALLVGDPNATRDKQGNLMLPRDDVVKLRDRLKNEEFVAGSFFCRMKYKRFRHELSSDYDYRREMCTHARILALEEAIDTEWVYMWDKFGGYLLLLLGLTAKAERVQDEVRLRLFLDSIGFSDLSAKKIKKWMPEDRRQFEIIQESYIREKEMEEEILMQRREEEGRGKERRKALLEKEERKWKEIEASLISSIPNAGNREAAAMAAAVRAVGGDSVLEDSFARERVSSIARRIRTAQLARRALQTGITGAICVLDDEPTTSGRHCGQIDASICQSQKVSFSIAVMIQPESGPVCLLGTEFQKKVCWEILVAGSEQGIEAGQVGLRLITKGDRQTTVAKDWSISATSIADGRWHIVTMTIDADIGEATCYLDGGFDGYQTGLALSAGNSIWEEGAEVWVGVRPPTDMDVFGRSDSEGAESKMHIMDVFLWGRCLTEDEIASLYSAICSAELNMNEFPEDNWQWADSPPRVDEWDSDPADVDLYDRDDIDWDGQYSSGRKRRADRDGIVVNVDSFARKFRKPRMETQEEIYQRMLSVELAVKEALSARGERQFTDHEFPPDDQSLYVDPGNPPSKLQVVAEWMRPSEIVKESRLDCQPCLFSGAVNPSDVCQGRLGDCWFLSAVAVLTEVSQISEVIITPEYNEEGIYTVRFCIQGEWVPVVVDDWIPCESPGKPAFATSKKGHELWVSILEKAYAKLHGSYEALEGGLVQDALVDLTGGAGEEIDMRSAQAQIDLASGRLWSQLLRFKQEGFLLGAGSPSGSDVHISSSGIVQGHAYSILQVREVDGHKLVQIRNPWANEVEWNGPWSDSSPEWTDRMKHKLKHVPQSKDGIFWMSWQDFQIHFRSIYVCRVYPSEMRYSVHGQWRGYSAGGCQDYASWNQNPQFRLRASGSDASFPIHVFITLTQSRFYDVLYWDEDTENSWSSCCSQHLPT
ccccccEEEEEEHHHHHHHHHHHHHHHHHHHHcccccccEEHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHEEEEEEEcccccccccccccccHHHHHHHHHHHHHHEEEEEEccccccHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccHHHHHHHHHHHHHHHHEEEEcccHHHHHHHHHccEEEEEEEccEEEEEcHHHHHHHHHHHHHHHHHEEEccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHcccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHccccccHHHHHHHHHccccccHHHHHccccccHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHEEEEEEEcccEEEEEccccccccccEEEEHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHcEEEEEECcCEEEEcccccccccccccccccccccEEEHHHHHHHHHHHHHHccEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHEEcccccccHHHHHHHHHHHHHHHccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccCCHHHHHHHHHHHHHHHHHHccccEEEEcccCEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHEEEEEEccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEcccccccccccccccccccHHHHHHHHHcccccccccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccccEEEEEEEEEECcccccEEEEccccHHHHHHHHHHccccccccccccEEEEEECccccCEEEEcccccccccccccEEEEEEEEEcccccEEEEEccccccccccccccccccccccccEEEEEccccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEcccccccccccccccEEEccccccccccccccccHHHHHHHHHHcccccccEEECcccccccEEEEEEEEEccCEEEEEEEccccccccccEEEEEcccccccHHHHHHHHHHcccccccccccccHHHHHHcccccccEEEEccccHHHHcHHHHHHHHHHHHHHccccCEEEEccccccccccccccccccEEEEEEEEEEccccEEEEEcccccccccccccccccccccHHHHHHHccccccccccccccHHHHHHcccEEEEEECcccccccccccCECcccccccccccccccccEEEEEECcccccccEEEEEEEccccccccccccccccccCEEECcccccc
****DKGIVLACAISGTLFAVLGSASFSILWAVNWRPWRLYSWIFARKWPNVLQGGQLGIICRFLALSAWMVVISPVAVLIMWGSWLIVILGRDIIGLAIIMAGTALLLAFYSIMLWWRTQWQSSRAVAVLLLLAVALLCAYELSAVYVTAGSHASDRYSPSGFFFGVSAIALAINMLFICRMVFNGNGLDVDEYVRRAYKFAYPDGIEMGPLACLPEPPDP*ELYPRQSSKASHLGLLYAGSLVVLFVYSILYGLTAMEARWLGAVTSAAVIILDWNMGACLYGFQLLQSRVAALFVAGTSRVFLICFGVHYWYLGHCISYAVVASVLLGAAVSRHLSVTNPLAARRDALQSTVIR**********************************************AQCSVD*TTWNNGVLC***********************************************DQNNSLVVCN********************ILDLNLALAFQERLNDPRI****************SLLQDKGLDPNFAMMLKEKSLDPTILALLQ*****************VI***********QISLSEELRLRGLEKWLQMSRFVLHKAAGTPERAWVLFSFIFILETISVAIFRPKTIRIINARHQQFEFGFAVLLLSPVVCSIMAFLRSFRAEEMAMTSKPRKYGFIAWLLSTSVGLLLSFLSKSSLLLGLSLTVPLMVACLSFAIPIWIRNGYQFKVPQVQCAA************EGIVLVICITVFTGSVLALGAIVSAKPLEDLGYKGWTGEPNSFASPYASSVYLGWLMASAIALVVTGVLPIVSWFSTYRFSLSSAICVGIFAAVLVAFCGASYLEVVKSREDQVPTKGDFLAALLPLVCIPALLSLCSGLLKWKDDDWKLSRGVYVFITIGLVLLLGAISAVIVVITPWTIGVAFLLLLLLIVLAIGVIHHWASNNFYLTRTQMFFVCFLAFLLGLAAFLVGWFDDKPFVGASVGYFTFLFLLAGRALTVLLSPPIVVYSPRVLPVYVYDAHADCGKNVSVAFLVLYGVALAIEGWGVVASLKIYPPFAGAAVSAITLVVAFGFAVSRPCLTLKTMEDAVHFLSKDTVVQAISRSATKT*********************VGDPNATRDKQGNLMLPRDDVVKLRDRLKNEEFVAGSFFCRMKYKRFRHELSSDYDYRREMCTHARILALEEAIDTEWVYMWDKFGGYLLLLLGLTAKAERVQDEVRLRLFLDSIGFSDLSAKKIKKWMPEDRRQFEIIQESY***************************************EASLISS********AAAMAAAVRAVGGDSVLEDSFARERVSSIARRIRTAQLARRALQTGITGAICVLDDEPTTSGRHCGQIDASICQSQKVSFSIAVMIQPESGPVCLLGTEFQKKVCWEILVAGSEQGIEAGQVGLRLITKGDRQTTVAKDWSISATSIADGRWHIVTMTIDADIGEATCYLDGGFDGYQTGLALSAGNSIWEEGAEVWVGVRPPTDMDVFGRSD****ESKMHIMDVFLWGRCLTEDEIASLYSAICSAELNMNEFPEDNWQWADSPPRV*EWDSDPADVDLYDRDDIDWDG*************GIVVNVDSFARK***********IYQRMLSVELAVKEALSARGERQFTDHEFPPDDQSLYVD********QVVAEWMRPSEIVKESRLDCQPCLFSGAVNPSDVCQGRLGDCWFLSAVAVLTEVSQISEVIITPEYNEEGIYTVRFCIQGEWVPVVVDDWIPCESPGKPAFATSKKGHELWVSILEKAYAKLHGSYEALEGGLVQDALVDLTGGAGEEIDMRSAQAQIDLASGRLWSQLLRFKQEGFLLGAG*****DVHISSSGIVQGHAYSILQVREVDGHKLVQIRNPWANEVEWNGPWSDSSPEWTDRMKHK***VPQSKDGIFWMSWQDFQIHFRSIYVCRVYPSEMRYSVHGQWRGYSAGGCQDYASWNQNPQFRLRASGSDASFPIHVFITLTQSRFYDVL***EDTENSWSSC*******
xxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGDDKGIVLACAISGTLFAVLGSASFSILWAVNWRPWRLYSWIFARKWPNVLQGGQLGIICRFLALSAWMVVISPVAVLIMWGSWLIVILGRDIIGLAIIMAGTALLLAFYSIMLWWRTQWQSSRAVAVLLLLAVALLCAYELSAVYVTAGSHASDRYSPSGFFFGVSAIALAINMLFICRMVFNGNGLDVDEYVRRAYKFAYPDGIEMGPLACLPEPPDPNELYPRQSSKASHLGLLYAGSLVVLFVYSILYGLTAMEARWLGAVTSAAVIILDWNMGACLYGFQLLQSRVAALFVAGTSRVFLICFGVHYWYLGHCISYAVVASVLLGAAVSRHLSVTNPLAARRDALQSTVIRLREGFRRKEQNSSSSSSEGCGSSVKRSSSAEAAHLGNIIEASSRSAAQCSVDVTTWNNGVLCRTASSHEGINSDKSMDSGRPSLALCSSSCRSVVQEPEAGTSFVDKNYDQNNSLVVCNSSGLDSQGCDSSTSTSANQQILDLNLALAFQERLNDPRITSMLKKRAREGDRELTSLLQDKGLDPNFAMMLKEKSLDPTILALLQRSSLDADRDHGDNTDVAVIDSNSVDNVMPNQISLSEELRLRGLEKWLQMSRFVLHKAAGTPERAWVLFSFIFILETISVAIFRPKTIRIINARHQQFEFGFAVLLLSPVVCSIMAFLRSFRAEEMAMTSKPRKYGFIAWLLSTSVGLLLSFLSKSSLLLGLSLTVPLMVACLSFAIPIWIRNGYQFKVPQVQCAATPGGNDQPPGKKEGIVLVICITVFTGSVLALGAIVSAKPLEDLGYKGWTGEPNSFASPYASSVYLGWLMASAIALVVTGVLPIVSWFSTYRFSLSSAICVGIFAAVLVAFCGASYLEVVKSREDQVPTKGDFLAALLPLVCIPALLSLCSGLLKWKDDDWKLSRGVYVFITIGLVLLLGAISAVIVVITPWTIGVAFLLLLLLIVLAIGVIHHWASNNFYLTRTQMFFVCFLAFLLGLAAFLVGWFDDKPFVGASVGYFTFLFLLAGRALTVLLSPPIVVYSPRVLPVYVYDAHADCGKNVSVAFLVLYGVALAIEGWGVVASLKIYPPFAGAAVSAITLVVAFGFAVSRPCLTLKTMEDAVHFLSKDTVVQAISRSATKTRNALSGTYSAPQRSASSTALLVGDPNATRDKQGNLMLPRDDVVKLRDRLKNEEFVAGSFFCRMKYKRFRHELSSDYDYRREMCTHARILALEEAIDTEWVYMWDKFGGYLLLLLGLTAKAERVQDEVRLRLFLDSIGFSDLSAKKIKKWMPEDRRQFEIIQESYIREKEMEEEILMQRREEEGRGKERRKALLEKEERKWKEIEASLISSIPNAGNREAAAMAAAVRAVGGDSVLEDSFARERVSSIARRIRTAQLARRALQTGITGAICVLDDEPTTSGRHCGQIDASICQSQKVSFSIAVMIQPESGPVCLLGTEFQKKVCWEILVAGSEQGIEAGQVGLRLITKGDRQTTVAKDWSISATSIADGRWHIVTMTIDADIGEATCYLDGGFDGYQTGLALSAGNSIWEEGAEVWVGVRPPTDMDVFGRSDSEGAESKMHIMDVFLWGRCLTEDEIASLYSAICSAELNMNEFPEDNWQWADSPPRVDEWDSDPADVDLYDRDDIDWDGQYSSGRKRRADRDGIVVNVDSFARKFRKPRMETQEEIYQRMLSVELAVKEALSARGERQFTDHEFPPDDQSLYVDPGNPPSKLQVVAEWMRPSEIVKESRLDCQPCLFSGAVNPSDVCQGRLGDCWFLSAVAVLTEVSQISEVIITPEYNEEGIYTVRFCIQGEWVPVVVDDWIPCESPGKPAFATSKKGHELWVSILEKAYAKLHGSYEALEGGLVQDALVDLTGGAGEEIDMRSAQAQIDLASGRLWSQLLRFKQEGFLLGAGSPSGSDVHISSSGIVQGHAYSILQVREVDGHKLVQIRNPWANEVEWNGPWSDSSPEWTDRMKHKLKHVPQSKDGIFWMSWQDFQIHFRSIYVCRVYPSEMRYSVHGQWRGYSAGGCQDYASWNQNPQFRLRASGSDASFPIHVFITLTQSRFYDVLYWDEDTENSWSSCCSQHLPT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QXP, chain A
Confidence level:very confident
Coverage over the Query: 1693-2061
View the alignment between query and template
View the model in PyMOL
Template: 3KQR, chain A
Confidence level:confident
Coverage over the Query: 1399-1598
View the alignment between query and template
View the model in PyMOL
Template: 3FLP, chain A
Confidence level:confident
Coverage over the Query: 1434-1618
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 1256-1263,1280-1359
View the alignment between query and template
View the model in PyMOL