Citrus Sinensis ID: 000177

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810------1820------1830------1840------1850------1860------1870------1880------1890------1900------1910------1920--

MEGSSSQGLSEAPVLEGGGGEGGGGGGGGEDETKKVEEELMAKAQKLMEKITSSPDNPNPSVLHALSSLFEIQESLYLEESGFSSNNARASHNIGRLGNLVRENDDFFELISSKFLSESRYSTSVQAAAARLVLSCSLTWIYPHAFEEPVVDNVKNWVMDETARLSCEDRHLKHHMSRKEASDSEMLKTYATGLLAVCLAGGGQVVEDVLTSGLSAKLMRYLRIRVLGETSQKDANHLAESKNSASATSLRGREEGRVRLRQILEHPDERTIDERSLDDQDIERVTHGDECGADDGEPHDGLAAGIDMSEAYTDAREGKTKLGDNDETGRDDSSRRRMNRGWIRSRGKGRINEGAIETDQGLTSPVSGSRLGQVRSIRDRSVSKSSDTKKAPDGRKHSGTIGSDGVFMEREDGDDCFQECRVGSKDISDMVKKAVRAAEAEARAANAPLEAIKAAGDAAAEVVKSAASEEFKTTNDEDAALLAASRAASTVIDAADAVEVSRNSISNNVDSVSVSVTETETNEDVEEYFIPDVESLAQLREKYCIQCLETLGEYVEVLGPVLHEKGVDVCLALLQRSSKYEEESKVAMLLPDVMKLICALAAHRKFAALFVDRGGMQKLLAVPRNNQTFFGLSSCLFTIGSLQGIMERVCALPTDVVHQLVELAIQLLECTQDQARKNAALFFAAAFVFRAIIDAFDAQDGLQKLLGLLNDAASVRSGVNAGAVGLSSSTSLRNDRSPPEVLTSSEKQIAYHTCVALRQYFRAHLLLLVDSIRPNKSNRSAGRNIPNVRAAYKPLDISNEAIDAVFLQLQKDRKLGPALVRTRWPAVDRFLSLNGHITLLELCQAPPVERYLHDLLQYALGVLHIVTLVPNSRKMIVNATLSNNHTGIAVILDAANAVSSYVDPEIIQPALNVLINLVCPPPSISNKPPLLAQGQQSVSGQTSNGPSMEPRDRNAERNVSDRVVYMPSQSDLRERNVDSSLLDRGSSANTQLACSTSQTPVPTPTSGLVGDRRISLGAGAGCAGLAAQLEQGYRQAREAVRANNGIKVLLHLLQPRIYSPPAALDCLRALACRVLLGLARDDTIAHILTKLQVGKKLSELIRDSGGQTPATEQGRWQAELSQVAIELIAIVTNSGRASTLAATDAATPTLRRIERAAIAAATPISYHSRELLLLIHEHLQASGLVTTAAQLLKEAQLTPLPSLAAPSSLAHQISTQESPSIQIQWPSGRSPGFLTGKSKLAARDEDISLKCDSSMSSKKKQLVFSPSFNLQSRHQSQSHDSQTPSSRKVFSNSKQSAVPSVLEIPHESVSKSNPDTDSQSKTPIALPMKRKLSELKDTGLSLSGKRLHTGDLGLRSPSCPTPNSVRKSSLLNDPQGFSTPGSLAEYLDDNQCGNYHAGQATPSFQLGALNDPQPSNSERITLDSLVVQYLKHQHRQCPAPITTLPPLSLLHPHVCPEPKRSLDAPSNVTARLGTREFKSTYSGVHRNRRDRQFVYSRFRPWRTCRDDAGALLTCITFLGDSSHIAVGSHTKELKIFDSNSSSPLESCTSHQAPVTLVQSHLSGETQLLLSSSSQDVHLWNASSIAGGPMHSFEGCKAARFSNSGNLFAALPTETSDRGILLYDIQTYQLEAKLSDTSVNLTGRGHAYSQIHFSPSDTMLLWNGILWDRRNSVPVHRFDQFTDHGGGGFHPAGNEVIINSEVWDLRKFRLLRSVPSLDQTTITFNARGDVIYAILRRNLEDVMSAVHTRRVKHPLFAAFRTVDAINYSDIATIPVDRCVLDFATERTDSFVGLITMDDQEDMFSSARIYEIGRRRPTEDDSDPDDAESDEEDEEDDDDVDVDPLLGADLDGDGDSEGDDLSNSDEDDSVSDLDDEDDGDFMMDDVDYDGGGGLLEIVTEGDEDEDSQLVESLSSGDEEDFIGF

cccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHcccccccccccccccccccccccccEEEccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccEEEEEEEEcccHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHEEEEEccccHHHHHcccccccccHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccCECcccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccEEEcHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHcccHHHccccccccccccccccEEEEcccccEEcccccccEEEEEEEcccccEEEEEcccccEEEEEccccccEEccccccccEEEEEEcccccccEEEEEccccEEEEEccccccccccccccccEEEEcccccEEcccccccccccEEEEEcccccEEEEccccccccccccccCEEEEEcccccEEEEccEEEEcccccCEEEcccccccCEEEEcccccEEEEcccccccccccEECcccccccEEEEEcccccEEEEEEccccccHHHcccccccccccccCEEEECcccccccEEEccccEEEEEEEcccccEEEEEEccccccccCEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccHHHHccccccccccccc

*****************************************AKAQKLMEKITSSPDNPNPSVLHALSSLFEIQESLYLEESGFSSNNARASHNIGRLGNLVRENDDFFELISSKFLSESRYSTSVQAAAARLVLSCSLTWIYPHAFEEPVVDNVKNWVMDET************************LKTYATGLLAVCLAGGGQVVEDVLTSGLSAKLMRYLRIRVLG*******************************************IDE*SL****************************IDMSEAY*****************************************************************************************************DDCFQECRVGSKDI************************************************************************************************DVEEYFIPDVESLAQLREKYCIQCLETLGEYVEVLGPVLHEKGVDVCLALLQRSSKYEEESKVAMLLPDVMKLICALAAHRKFAALFVDRGGMQKLLAVPRNNQTFFGLSSCLFTIGSLQGIMERVCALPTDVVHQLVELAIQLLECTQDQARKNAALFFAAAFVFRAIIDAFDAQDGLQKLLGLLNDAASVRSGVNAGAVG***************VLTSSEKQIAYHTCVALRQYFRAHLLLLVDSI************IPNVRAAYKPLDISNEAIDAVFLQLQKDRKLGPALVRTRWPAVDRFLSLNGHITLLELCQAPPVERYLHDLLQYALGVLHIVTLVPNSRKMIVNATLSNNHTGIAVILDAANAVSSYVDPEIIQPALNVLINLVCPPPSISNKP********************************DRVVYMPSQSDLRERNVDSSLLDRGSSANTQLACSTS***********VGDRRISLGAGAGCAGLAAQLEQGYRQAREAVRANNGIKVLLHLLQPRIYSPPAALDCLRALACRVLLGLARDDTIAHILTKLQVGKKLSELI**************WQAELSQVAIELIAIVTNSGRASTLAATDAATPTLRRIERAAIAAATPISYHSRELLLLIHEHLQASGLVTTAAQLLKEAQ************************************************************************************************************************************************************************************FSTPGSLAEYL********************************ITLDSLVVQYLKHQHRQCPAPITTLPPLSLLHPHVCP**********NVTARLGTREFKSTYSGVHRNRRDRQFVYSRFRPWRTCRDDAGALLTCITFLGDSSHIAVGSHTKELKIFDSNSSSPLESCTSHQAPVTLVQSHLSGETQLLLSSSSQDVHLWNASSIAGGPMHSFEGCKAARFSNSGNLFAALPTETSDRGILLYDIQTYQLEAKLSDTSVNLTGRGHAYSQIHFSPSDTMLLWNGILWDRRNSVPVHRFDQFTDHGGGGFHPAGNEVIINSEVWDLRKFRLLRSVPSLDQTTITFNARGDVIYAILRRNLEDVMSAVHTRRVKHPLFAAFRTVDAINYSDIATIPVDRCVLDFATERTDSFVGLITMDDQEDMFSSARIYEIG**************************************************************************YDGGGGLLEI***************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DDB1- and CUL4-associated factor homolog 1	Component of the CUL4-RBX1-DDB1-DCAF1 E3 ubiquitin-protein ligase complex, DCAF1 may function as the substrate recognition module within this complex. Appears to be required for plant embryogenesis and to affect several other developmental processes including leaf, shoot, and flower development.	probable	Q9M086

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VYH, chain C
Confidence level:confident
Coverage over the Query: 1502-1735,1755-1809
View the alignment between query and template
View the model in PyMOL

Template: 3SFZ, chain A
Confidence level:confident
Coverage over the Query: 1490-1812
View the alignment between query and template
View the model in PyMOL

Template: 4HXT, chain A
Confidence level:confident
Coverage over the Query: 541-710
View the alignment between query and template
View the model in PyMOL

Template: 1JDH, chain A
Confidence level:probable
Coverage over the Query: 542-710,735-763,775-780,797-933,945-975,991-993,1006-1131
View the alignment between query and template
View the model in PyMOL