Citrus Sinensis ID: 000235


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810-----
MDTRFPYSPAEVAKVRMVQFGILSPDEIRQMSVVQIEHGETTERGKPKPGGLSDPRLGTIDRKMKCETCTANMAECPGHFGHLELAKPMFHIGFMKTVLSIMRSVCFNCSKILADEDDHKFKQALKIRNPKNRLKKILDACKNKTKCEGGDEIDVPGQDGEEPLKKNKGGCGAQQPKLTIEGMKMIAEYKAQRKKNDDQEQLPEPVERKQTLTAERVLGVLKRISDEDCQLLGLNPKYARPDWMILQVLPIPPPPVRPSDDLTHQLAMIIRHNENLRRQERNGAPAHIISEFAQLLQFHIATYFDNELPGQPRATQRSGRPIKSICSRLKAKEGRIRGNLMGKRVDFSARTVITPDPTINIDQLGVPWSIALNLTYPETVTPYNIERLKELVEYGPHPPPGKTGAKYIIRDDGQRLDLRYLKKSSDHHLELGYKVERHLNDGDFVLFNRQPSLHKMSIMGHRIKIMPYSTFRLNLSVTSPYNADFDGDEMNMHVPQSFETRAEVLELMMVPKCIVSPQSNRPVMGIVQDTLLGCRKITKRDTFIEKDVFMNILMWWEDFDGKVPQPTILKPRPLWTGKQVFNLIIPKQINLFRTAAWHADNDKGILTAGDTLVRIEKGELLSGTLCKKTLGTSTGSLIHVIWEEVGPDAARKFLGHTQWLVNYWLLQNAFSIGIGDTIADAKTMETINDTISKAKNNVKNLIKQAQDKSLEPEPGRTMMESFENKVNQVLNTARDEAGSSAQKSLSESNNLKAMVTAGSKGSFINISQMTACVGQQNVEGKRIPFGFVDRTLPHFTKDDYGPESRGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTSETGYIQRRLVKAMEDIMVKYDGTVRNSLGDVIQFLYGEDGMDSVWIESQTLDSLKMKKSEFDKAFRFEMDEENWNPNYMLQEYIDDLKTIKELRDVFDAEVQKLEADRYQLATEIATSGDSSWPLPVNLKRLIWNAQKTFKVDPRRPSDMHPMEVVEAVDKLQERLKVVPGEDPLSVEAQKNATLFFNILLRSTFASKRVLKEHRLTREAFEWVIGEIESRFLQSLVAPGEMIGCVAAQSIGEPATQMTLNTFHYAGVSAKNVTLGVPRLREIINVAKKIKTPSLSVFLKPGVNSTKERAKNVQCALEYTTLRSVTEATEVWYDPDPMGTIIEEDVEFVKSYYEMPDEDIAPEKISPWLLRIELNREMMVDKKLSMAAVAEKINQEFDDDLTCIFNDDNADKLILRIRIMNDEAPKGELNDESAEDDVFLKKIESNMLTEMALRGVNLLAVMCHEDVDARRTTSNHLIEIIEVLGIEAVRRALLDELRVVISFDGSYVNYRHLAILCDTMTYRGHLMAITRHGINRNDTGPMMRCSFEETVDILLDAAVFAESDYLRGVTENIMLGQLAPIGTGDCSLYLNDEMLKNAIELQLPSYMEGLEFGMTPARSPVSGTPYHDGMMSPGYLFSPNLRLSPVTDAQFSPYVGGMAFSPTSSPGYSPSSPGYSPSSPGYSPTSPGYSPTSPGYSPTSPGYSPTSPTYSPSSPGYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPGYSPTSPSYSPTSPTYSPTSPSYNPQSAKYSPSLAYSPSSPRLSPASPYSPTSPNYSPTSSSYSPTSPSYSPSSPTYSPSSPYNAGGGNPDYSPSSPQYSPSAGYSPSAPGYSPSSTSQYTPQTNRDDSTTKDDKNTKGDKSSR
cccccccccccccEEcEEEEEcccHHHHHHccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEccEEEEEEHHHcccccccccccccccccccccHHHHHHHHccccHHHHHHHcccccccccccEEEEEECccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHcccccccccHHHHHHHHHHHHccccccccccccEEEEcccccEEEEccccccHHHccccccEEEEEcccccEEEEcccccccccccccCEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccEEEEEcEEEEEEEEcccccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHEEccccEEEEEEccccccccccccccccccccEEEccEEEEEEccccccccccccEEEHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccccHHHHHHHHHcccCECccccccccccccccccccccccccccccccccccccccccccccHHccccccccHHHcccccccHHHHHHHHHHHccEEEcccccEEcccccEEEEcccccccccHHHcccccccccccHHHHHHHcccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHHHccccHHcccEEEEEEEccccccCEEEccHHHHHHHHccccccccccccccccEEEEEcccccccccccHHHHHHHHHccccccccEEEcccccccEEEEEEEccccccccccccccccccEEEEccccccEEEEEEccccHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccEEccccccccccccccccccccHHHHHHHHHHHHcccccccccccccHHcccccccccccEEEEEcHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*****PY**AEVAKVRMVQFGILSPDEIRQMSVVQIEHGETTERGKPKPGGLSDPRLGTIDRKMKCETCTANMAECPGHFGHLELAKPMFHIGFMKTVLSIMRSVCFNCSKILADEDDHKFKQALKIRNPKNRLKKILDACKNKTKCEGG*******************GCGAQQPKLTIEGMKMIAEYKA******************QTLTAERVLGVLKRISDEDCQLLGLNPKYARPDWMILQVLPIPPPPVRPSDDLTHQLAMIIRHNENL*******APAHIISEFAQLLQFHIATYFDNE******************CSRLKAKEGRIRGNLMGKRVDFSARTVITPDPTINIDQLGVPWSIALNLTYPETVTPYNIERLKELVEYGPHPPPGKTGAKYIIRDDGQRLDLRYLKKSSDHHLELGYKVERHLNDGDFVLFNRQPSLHKMSIMGHRIKIMPYSTFRLNLSVTSPYNADFDGDEMNMHVPQSFETRAEVLELMMVPKCIVSPQSNRPVMGIVQDTLLGCRKITKRDTFIEKDVFMNILMWWEDFDGKVPQPTILKPRPLWTGKQVFNLIIPKQINLFRTAAWHADNDKGILTAGDTLVRIEKGELLSGTLCKKTLGTSTGSLIHVIWEEVGPDAARKFLGHTQWLVNYWLLQNAFSIGIGDTIADAKTMETINDTISKAKNNVKNLIKQAQDKSLEPEPGRTMMESFENKVNQVLNTARDEAGSSAQKSLSESNNLKAMVTAGSKGSFINISQMTACVGQQNVEGKRIPFGFVDRTLPHFTKDDYGPESRGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTSETGYIQRRLVKAMEDIMVKYDGTVRNSLGDVIQFLYGEDGMDSVWIESQTLDSLKMKKSEFDKAFRFEMDEENWNPNYMLQEYIDDLKTIKELRDVFDAEVQKLEADRYQLATEIATSGDSSWPLPVNLKRLIWNAQKTFKVDPRRPSDMHPMEVVEAVDKLQERLKVVPGEDPLSVEAQKNATLFFNILLRSTFASKRVLKEHRLTREAFEWVIGEIESRFLQSLVAPGEMIGCVAAQSIGEPATQMTLNTFHYAGVSAKNVTLGVPRLREIINVAKKIKTPSLSVFLKPGVNSTKERAKNVQCALEYTTLRSVTEATEVWYDPDPMGTIIEEDVEFVKSYYEMPDEDIAPEKISPWLLRIELNREMMVDKKLSMAAVAEKINQEFDDDLTCIFNDDNADKLILRIRIMNDEAPKGELNDESAEDDVFLKKIESNMLTEMALRGVNLLAVMCHEDVDARRTTSNHLIEIIEVLGIEAVRRALLDELRVVISFDGSYVNYRHLAILCDTMTYRGHLMAITRHGINRNDTGPMMRCSFEETVDILLDAAVFAESDYLRGVTENIMLGQLAPIGTGDCSLYLNDEMLKNAIELQLPSYMEGLEFGM*******************GYLFSPNLRLSPVTDAQFSPYV******************************************************************************************************************************************************************************************************************************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTRFPYSPAEVAKVRMVQFGILSPDEIRQMSVVQIEHGETTERGKPKPGGLSDPRLGTIDRKMKCETCTANMAECPGHFGHLELAKPMFHIGFMKTVLSIMRSVCFNCSKILADEDDHKFKQALKIRNPKNRLKKILDACKNKTKCEGGDEIDVPGQDGEEPLKKNKGGCGAQQPKLTIEGMKMIAEYKAQRKKNDDQEQLPEPVERKQTLTAERVLGVLKRISDEDCQLLGLNPKYARPDWMILQVLPIPPPPVRPSDDLTHQLAMIIRHNENLRRQERNGAPAHIISEFAQLLQFHIATYFDNELPGQPRATQRSGRPIKSICSRLKAKEGRIRGNLMGKRVDFSARTVITPDPTINIDQLGVPWSIALNLTYPETVTPYNIERLKELVEYGPHPPPGKTGAKYIIRDDGQRLDLRYLKKSSDHHLELGYKVERHLNDGDFVLFNRQPSLHKMSIMGHRIKIMPYSTFRLNLSVTSPYNADFDGDEMNMHVPQSFETRAEVLELMMVPKCIVSPQSNRPVMGIVQDTLLGCRKITKRDTFIEKDVFMNILMWWEDFDGKVPQPTILKPRPLWTGKQVFNLIIPKQINLFRTAAWHADNDKGILTAGDTLVRIEKGELLSGTLCKKTLGTSTGSLIHVIWEEVGPDAARKFLGHTQWLVNYWLLQNAFSIGIGDTIADAKTxxxxxxxxxxxxxxxxxxxxxxxxxxxxPEPGRTMMESFENKVNQVLNTARDEAGSSAQKSLSESNNLKAMVTAGSKGSFINISQMTACVGQQNVEGKRIPFGFVDRTLPHFTKDDYGPESRGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTSETGYIQRRLVKAMEDIMVKYDGTVRNSLGDVIQFLYGEDGMDSVWIESQTLDSLKMKKSEFDKAFRFEMDEENWNPNYMLQEYIDDxxxxxxxxxxxxxxxxxxxxxRYQLATEIATSGDSSWPLPVNLKRLIWNAQKTFKVDPRRPSDMHPMEVVEAVDKLQERLKVVPGEDPLSVEAQKNATLFFNILLRSTFASKRVLKEHRLTREAFEWVIGEIESRFLQSLVAPGEMIGCVAAQSIGEPATQMTLNTFHYAGVSAKNVTLGVPRLREIINVAKKIKTPSLSVFLKPGVNSTKERAKNVQCALEYTTLRSVTEATEVWYDPDPMGTIIEEDVEFVKSYYEMPDEDIAPEKISPWLLRIELNREMMVDKKLSMAAVAEKINQEFDDDLTCIFNDDNADKLILRIRIMNDEAPKGELNDESAEDDVFLKKIESNMLTEMALRGVNLLAVMCHEDVDARRTTSNHLIEIIEVLGIEAVRRALLDELRVVISFDGSYVNYRHLAILCDTMTYRGHLMAITRHGINRNDTGPMMRCSFEETVDILLDAAVFAESDYLRGVTENIMLGQLAPIGTGDCSLYLNDEMLKNAIELQLPSYMEGLEFGMTPARSPVSGTPYHDGMMSPGYLFSPNLRLSPVTDAQFSPYVGGMAFSPTSSPGYSPSSPGYSPSSPGYSPTSPGYSPTSPGYSPTSPGYSPTSPTYSPSSPGYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPGYSPTSPSYSPTSPTYSPTSPSYNPQSAKYSPSLAYSPSSPRLSPASPYSPTSPNYSPTSSSYSPTSPSYSPSSPTYSPSSPYNAGGGNPDYSPSSPQYSPSAGYSPSAPGYSPSSTSQYTPQTNRDDSTTKDDKNTKGDKSSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA-directed RNA polymerase II subunit RPB1 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Forms the polymerase active center together with the second largest subunit. Pol II is the central component of the basal RNA polymerase II transcription machinery. During a transcription cycle, Pol II, general transcription factors and the Mediator complex assemble as the preinitiation complex (PIC) at the promoter. 11-15 base pairs of DNA surrounding the transcription start site are melted and the single stranded DNA template strand of the promoter is positioned deeply within the central active site cleft of Pol II to form the open complex. After synthesis of about 30 bases of RNA, Pol II releases its contacts with the core promoter and the rest of the transcription machinery (promoter clearance) and enters the stage of transcription elongation in which it moves on the template as the transcript elongates. Pol II appears to oscillate between inactive and active conformations at each step of nucleotide addition. Elongation is influenced by the phosphorylation status of the C-terminal domain (CTD) of Pol II largest subunit (RPB1), which serves as a platform for assembly of factors that regulate transcription initiation, elongation, termination and mRNA processing. Pol II is composed of mobile elements that move relative to each other. The core element with the central large cleft comprises RPB3, RBP10, RPB11, RPB12 and regions of RPB1 and RPB2 forming the active center. The clamp element (portions of RPB1, RPB2 and RPB3) is connected to the core through a set of flexible switches and moves to open and close the cleft. A bridging helix emanates from RPB1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol II by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition. In elongating Pol II, the lid loop (RPB1) appears to act as a wedge to drive apart the DNA and RNA strands at the upstream end of the transcription bubble and guide the RNA strand toward the RNA exit groove located near the base of the largely unstructured CTD domain of RPB1. The rudder loop (RPB1) interacts with single stranded DNA after separation from the RNA strand, likely preventing reassociation with the exiting RNA. The cleft is surrounded by jaws: an upper jaw formed by portions of RBP1, RPB2 and RPB9, and a lower jaw, formed by RPB5 and portions of RBP1. The jaws are thought to grab the incoming DNA template, mainly by RPB5 direct contacts to DNA.probableP04050
DNA-directed RNA polymerase II subunit RPB1 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Forms the polymerase active center together with the second largest subunit. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB1 is part of the core element with the central large cleft, the clamp element that moves to open and close the cleft and the jaws that are thought to grab the incoming DNA template. At the start of transcription, a single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol II. A bridging helix emanates from RPB1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol II by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition. During transcription elongation, Pol II moves on the template as the transcript elongates. Elongation is influenced by the phosphorylation status of the C-terminal domain (CTD) of Pol II largest subunit (RPB1), which serves as a platform for assembly of factors that regulate transcription initiation, elongation, termination and mRNA processing.probableP04052
DNA-directed RNA polymerase II subunit rpb1 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Forms the polymerase active center together with the second largest subunit. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB1 is part of the core element with the central large cleft, the clamp element that moves to open and close the cleft and the jaws that are thought to grab the incoming DNA template. At the start of transcription, a single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol II. A bridging helix emanates from RPB1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol II by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition. During transcription elongation, Pol II moves on the template as the transcript elongates. Elongation is influenced by the phosphorylation status of the C-terminal domain (CTD) of Pol II largest subunit (RPB1), which serves as a platform for assembly of factors that regulate transcription initiation, elongation, termination and mRNA processing.probableP35084

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.7.-Nucleotidyltransferases.probable
2.7.7.6DNA-directed RNA polymerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HQM, chain D
Confidence level:very confident
Coverage over the Query: 240-429,445-655,669-793,808-865
View the alignment between query and template
View the model in PyMOL
Template: 4AYB, chain A
Confidence level:very confident
Coverage over the Query: 14-150,165-191,207-906
View the alignment between query and template
View the model in PyMOL
Template: 3QQC, chain A
Confidence level:very confident
Coverage over the Query: 1-147,165-202,213-331,366-395
View the alignment between query and template
View the model in PyMOL
Template: 4AYB, chain C
Confidence level:confident
Coverage over the Query: 1008-1089,1103-1163,1196-1425
View the alignment between query and template
View the model in PyMOL
Template: 2WAQ, chain C
Confidence level:confident
Coverage over the Query: 1031-1087,1105-1420
View the alignment between query and template
View the model in PyMOL
Template: 3DZY, chain A
Confidence level:probable
Coverage over the Query: 1642-1678
View the alignment between query and template
View the model in PyMOL
Template: 3DZY, chain A
Confidence level:probable
Coverage over the Query: 1642-1678
View the alignment between query and template
View the model in PyMOL
Template: 3DZY, chain A
Confidence level:probable
Coverage over the Query: 1642-1678
View the alignment between query and template
View the model in PyMOL
Template: 1DEQ, chain A
Confidence level:probable
Coverage over the Query: 1414-1475
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3h0g, chain Avery confident Alignment | Template Structure