Citrus Sinensis ID: 000380


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600-
MPDGESTVEGSQPSGGGTKICAATSAVVEECSVAVSGVGFGAESSVGAQKTDKDPKQIARKYQLELCKKAMEENIIVYLGTGCGKTHIAVLLIYELAHLIRKPQKSICIFLAPTVALVQQQAKVIEESIGFKVRTFCGGSKRLKSHCDWEKEIDQYEVLVMIPQILLYCLYHRFIKMELIALLIFDECHHAQVKSNHPYAKIMKDFYKPDIMKVPRIFGMTASPVVGKGASAQANLPKSINSLENLLDAKVYSVEDAEDLESFVSSPVVRVYQYGPVINDTSSSYVTCSEQLAEIKREQYISALSRKLHDHQSLRNTTKQLNRLHDSMKFCLENLGVCGALHASYILLSGDETMRNELIEAEGNTIDDSLCRFASQASEVFAAICRRDGIASDLSCIEVLKEPFFSKKLLRLIGILSTFRLQQHMKCIVFVNRIVTARALSYILQNLKFLASWRCHFLVGVNAGLKSMSRNAMKSILEKFRSGELNLLVATKVGEEGLDIQTCCLVIRFDLPETVASFIQSRGRARMPQSEYAFLVDSGNQRELDLIKNFSKEEDRMNREIMDRTSSDAFTCSEERIYKVDSSGACISAGYGVSLLHRYCSKLPHDEFFNPKPKFYYFDDLGGTICHIILPANAPIHQIVGTPQSSMEAAKKDACLKAIEDLHKLGALNDYLLPQEDNATEDEPMLFSSDSDSYEGEGSRGELHEMLVPAVLRQSWTKSQYPVRLNFYFMQFIPDPADRIYREFGLFVKSLLPGEAEHLKVDLHLARGRSVMTKLVPSGIMQAQQFQEMFLKVILDRSEFNSEFVPLGKDDYCESSSSTFYLLLPVIFHKNSVDWKIIRRCLSSPVFGTPGGSVDRKSLPSHGPLQLHNGWSSESDVENSLVYATHKKWFYLVTNIVFEKNGYSPYKDSDSSSHVDHLISSYGIHLKHPKQPLLRAKPLFRLRNLLHNRKLEDSESHELEEYFDDLPPELCQLKIIGFSKDIGSSLSLLPSIMHRLENLLVAIELKHLLSASFPEGAEVSAEMLLKALTTEKCQERFSLERLEILGDAFLKYAVGRHLFLLHDTVDEGELTRRRSNAVNNSNLLKLAARNNLQVYIRDQPFDPCQFFALGRRCPRICSKETERTIHSQYDGRAPDDLNAEVRCSKGHHWLHKKTIADVVEALVGAFIDDSGFKAATAFLKWIGIQVEFEASQVTNICISSKSFLPLSASLDMATLEILLGHQFLHRGLLLQAFVHPSFNRLGGCYQRLEFLGDAVLDYLITSYLYSVYPKLKPGQLTDLRSMLVNNQAFANVAVDQSFYKFLIFDSNVLSETINNYVDYMITPSSTREVKEGPRCPKVLGDLVESSLGAILLDSGFNLNTVWKIMLSFLDPILKFSNLQLNPIRELLELCNSYDLDLQFPSLKKGGKFLAEAKVTGKDKDVFISACATNLSRKEAIRIASQQLFSKLKAAGYVPKTKSLESILKSSPKSEARLIGYDETPINVVAADDNVFEKLKISEPQGGSSCDIGSPSLTTGGLQNRSARSRLYELCAANCWKPPTFDCCKEEGLSHLKLFTFRVIVEIEAPEKIIECIGEPQAKKKGAAEHAAEGMLWCLEREGYLY
cccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHHccccEEEECccccccccHHHHHHcccccEEEEEcHHHHHHHHHccccccccEEEEEEEcccccccccccHHHHHHHHHccccccccccEEEEEcccccccccccccccHHHHHHHHHHcccCEEEcccHHHHHccccccCEEEEECcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccccccHHHHHHHHHHHHHccccccEEEEEEEEHHHHHHHHHHHHHcccccccEEEEEEccccccccccHHHHHHHHHHHHcccccEEEEEcccccccccccccEEEEEcccccHHHHHHHccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEcccccccccccccHHHHHHHHHccccccccccccEEEEEEccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccEEEEEEEEEECccccccccccEEEEEcccccccccccEEEEEEccccEEEEEEcHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEcccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEccccEEEEEEEEccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHcccccccccccHHHHHHcHHHHHHHHHHHHHHHccccccccHHHHHHHccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccHHHHHHHHHHHccccHHcccccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcEEEcccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccccccccEEccccEEEEEEEEEEEEccEEEEEEEEcccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccHHHHHHHHHHHccccccccEEEEcccccccccEEEEEEEEECccccEEEECccccccccHHHHHHHHHHHHHHHHccccc
********************************************************QIARKYQLELCKKAMEENIIVYLGTGCGKTHIAVLLIYELAHLIRKPQKSICIFLAPTVALVQQQAKVIEESIGFKVRTFCGGSKRLKSHCDWEKEIDQYEVLVMIPQILLYCLYHRFIKMELIALLIFDECHHAQVKSNHPYAKIMKDFYKPDIMKVPRIFGMTASPVVGKGASAQANLPKSINSLENLLDAKVYSVEDAEDLESFVSSPVVRVYQYGPVINDTSSSYVTCSEQLAEIKREQYISALSRK**********TKQLNRLHDSMKFCLENLGVCGALHASYILLSGDETMRNELIEAEGNTIDDSLCRFASQASEVFAAICRRDGIASDLSCIEVLKEPFFSKKLLRLIGILSTFRLQQHMKCIVFVNRIVTARALSYILQNLKFLASWRCHFLVGVNAGLKSMSRNAMKSILEKFRSGELNLLVATKVGEEGLDIQTCCLVIRFDLPETVASFIQS******PQSEYAFLVDSGNQRELDLIKNFSKEEDRMNRE*********FTCSEERIYKVDSSGACISAGYGVSLLHRYCSKLPHDEFFNPKPKFYYFDDLGGTICHIILPANAPIHQIVGT***SMEAAKKDACLKAIEDLHKLGALNDYLLPQEDNATED******************GELHEMLVPAVLRQSWTKSQYPVRLNFYFMQFIPDPADRIYREFGLFVKSLLPGEAEHLKVDLHLARGRSVMTKLVPSGIMQAQQFQEMFLKVILDRSEFNSEFVPLGKDDYCESSSSTFYLLLPVIFHKNSVDWKIIRRCLSSPVFGTPGGSVDRKSLPSHGPLQLHNGWSSESDVENSLVYATHKKWFYLVTNIVFEKNGYSP*********VDHLISSYGIHLKHPKQPLLRAKPLFRLRNLLHN***********EEYFDDLPPELCQLKIIGFSKDIGSSLSLLPSIMHRLENLLVAIELKHLLSASFPEGAEVSAEMLLKALTTEKCQERFSLERLEILGDAFLKYAVGRHLFLLHDTVDEGELTRRRSNAVNNSNLLKLAARNNLQVYIRDQPFDPCQFFALGRRCPRICSKETERTI**********************HWLHKKTIADVVEALVGAFIDDSGFKAATAFLKWIGIQVEFEASQVTNICISSKSFLPLSASLDMATLEILLGHQFLHRGLLLQAFVHPSFNRLGGCYQRLEFLGDAVLDYLITSYLYSVYPKLKPGQLTDLRSMLVNNQAFANVAVDQSFYKFLIFDSNVLSETINNYVDYMITPSS******GPRCPKVLGDLVESSLGAILLDSGFNLNTVWKIMLSFLDPILKFSNLQLNPIRELLELCNSYDLDLQFPSLKKGGKFLAEAKVTGKDKDVFISACATNLSRKEAIRIASQQLFSKLKAAGYV************************ETPINVV************************************SARSRLYELCAANCWKPPTFDCCKEEGLSHLKLFTFRVIVEIEAPEKIIECIGE***********AAEGMLWCLEREGYL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPDGESTVEGSQPSGGGTKICAATSAVVEECSVAVSGVGFGAESSVGAQKTDKDPKQIARKYQLELCKKAMEENIIVYLGTGCGKTHIAVLLIYELAHLIRKPQKSICIFLAPTVALVQQQAKVIEESIGFKVRTFCGGSKRLKSHCDWEKEIDQYEVLVMIPQILLYCLYHRFIKMELIALLIFDECHHAQVKSNHPYAKIMKDFYKPDIMKVPRIFGMTASPVVGKGASAQANLPKSINSLENLLDAKVYSVEDAEDLESFVSSPVVRVYQYGPVINDTSSSYVTCSEQLAEIKREQYISALSRKLHDHQSLRNTTKQLNRLHDSMKFCLENLGVCGALHASYILLSGDETMRNELIEAEGNTIDDSLCRFASQASEVFAAICRRDGIASDLSCIEVLKEPFFSKKLLRLIGILSTFRLQQHMKCIVFVNRIVTARALSYILQNLKFLASWRCHFLVGVNAGLKSMSRNAMKSILEKFRSGELNLLVATKVGEEGLDIQTCCLVIRFDLPETVASFIQSRGRARMPQSEYAFLVDSGNQRELDLIKNFSKEEDRMNREIMDRTSSDAFTCSEERIYKVDSSGACISAGYGVSLLHRYCSKLPHDEFFNPKPKFYYFDDLGGTICHIILPANAPIHQIVGTPQSSMEAAKKDACLKAIEDLHKLGALNDYLLPQEDNATEDEPMLFSSDSDSYEGEGSRGELHEMLVPAVLRQSWTKSQYPVRLNFYFMQFIPDPADRIYREFGLFVKSLLPGEAEHLKVDLHLARGRSVMTKLVPSGIMQAQQFQEMFLKVILDRSEFNSEFVPLGKDDYCESSSSTFYLLLPVIFHKNSVDWKIIRRCLSSPVFGTPGGSVDRKSLPSHGPLQLHNGWSSESDVENSLVYATHKKWFYLVTNIVFEKNGYSPYKDSDSSSHVDHLISSYGIHLKHPKQPLLRAKPLFRLRNLLHNRKLEDSESHELEEYFDDLPPELCQLKIIGFSKDIGSSLSLLPSIMHRLENLLVAIELKHLLSASFPEGAEVSAEMLLKALTTEKCQERFSLERLEILGDAFLKYAVGRHLFLLHDTVDEGELTRRRSNAVNNSNLLKLAARNNLQVYIRDQPFDPCQFFALGRRCPRICSKETERTIHSQYDGRAPDDLNAEVRCSKGHHWLHKKTIADVVEALVGAFIDDSGFKAATAFLKWIGIQVEFEASQVTNICISSKSFLPLSASLDMATLEILLGHQFLHRGLLLQAFVHPSFNRLGGCYQRLEFLGDAVLDYLITSYLYSVYPKLKPGQLTDLRSMLVNNQAFANVAVDQSFYKFLIFDSNVLSETINNYVDYMITPSSTREVKEGPRCPKVLGDLVESSLGAILLDSGFNLNTVWKIMLSFLDPILKFSNLQLNPIRELLELCNSYDLDLQFPSLKKGGKFLAEAKVTGKDKDVFISACATNLSRKEAIRIASQQLFSKLKAAGYVPKTKSLESILKSSPKSEARLIGYDETPINVVAADDNVFEKLKISEPQGGSSCDIGSPSLTTGGLQNRSARSRLYELCAANCWKPPTFDCCKEEGLSHLKLFTFRVIVEIEAPEKIIECIGEPQAKKKGAAEHAAEGMLWCLEREGYLY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Endoribonuclease Dicer homolog 4 Involved in the RNA silencing pathway. Cleaves double-stranded RNA to produce small interfering RNAs (siRNAs) which target the selective destruction of complementary RNAs. Required for the production of 21 nucleotide siRNAs. Regulates shoot apical meristem (SAM) initiation and maintenance, leaf polarization and lemma polarity through the trans-acting siRNAS (ta-siRNAs) pathway, which probably modulate the expression of the ARF2, ARF3, ARF4, ARF14 and ARF15 genes. Can process endogenous 21 nucleotide siRNAs derived from an imperfect inverted repeat. May not be involved in microRNAs (miRNAs) production.probableA7LFZ6
Dicer-like protein 4 Ribonuclease (RNase) III involved in RNA-mediated post-transcriptional gene silencing (PTGS). Functions in the biogenesis of trans-acting small interfering RNAs (ta-siRNAs, derived from the TAS1, TAS2 or TAS3 endogenous transcripts) by cleaving small dsRNAs into 21-24 nucleotide ta-siRNAs. Functions with the dsRNA-binding protein DRB4 in ta-siRNAs processing. Acts in the RDR6/SGS3/DCL4/AGO7 ta-siRNA pathway involved in leaf developmental timing. Plays a role in transitive silencing of transgenes by processing secondary siRNAs. This pathway, which requires DCL2 and RDR6, amplifies silencing by using the target RNA as substrate to generate secondary siRNAs, providing an efficient mechanism for long-distance silencing. Required for the production of the 30-40 nucleotide bacterial-induced long siRNAs (lsiRNA). May participate with DCL3 in the production of 24 nucleotide repeat-associated siRNAs (ra-siRNAs) which derive from heterochromatin and DNA repeats such as transposons. Plays an important role in antiviral RNA silencing. Involved in the production of viral siRNAs derived from the cucumber mosaic virus (CMV), turnip crinkle virus (TCV) and tobacco rattle virus (TRV). Targeted by the viral silencing suppressor (VSR) protein 2b of the cucumber mosaic virus (CMV) that inactivates DCL4 function in RNA silencing. Does not seem to be involved in microRNAs (miRNAs) processing.probableP84634

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YKG, chain A
Confidence level:very confident
Coverage over the Query: 52-457,484-671
View the alignment between query and template
View the model in PyMOL
Template: 3C4B, chain A
Confidence level:very confident
Coverage over the Query: 1211-1434
View the alignment between query and template
View the model in PyMOL
Template: 3C4B, chain A
Confidence level:confident
Coverage over the Query: 1211-1434
View the alignment between query and template
View the model in PyMOL
Template: 2KOU, chain A
Confidence level:confident
Coverage over the Query: 587-684
View the alignment between query and template
View the model in PyMOL
Template: 2QVW, chain A
Confidence level:probable
Coverage over the Query: 849-1099,1144-1204
View the alignment between query and template
View the model in PyMOL
Template: 2DIX, chain A
Confidence level:probable
Coverage over the Query: 1514-1598
View the alignment between query and template
View the model in PyMOL