Citrus Sinensis ID: 000448


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------150
MEVDSDAEKSNECKKFVVNNNNNNHSNEGQQGKPKRQMKTPFQLETLEKAYASETYPSESTRAELSEKLGLSDRQLQMWFCHRRLKDKKEKENPPKKMRKNVAVVMPESPIDELRAGAEPGSDYGSGSGSGSSPYLMELRNAVGSSRGLMDDMPIVRRSYESQQSIMELRAIACVEAQLGEPLREDGPILGMEFDSLPPDAFGAPIGSSEQQKRSGHPYESKIYDRYDTKSNKVIPRAHHEYQSLSDQPYFHGSPIDGSRARTSFLHANEPSSRVHGVQGHVARVRVLSQQDKPAHIFSSPNGGEDSLLQRESTSNNRKNAQSTSHPIFGTEDPYLLSDGQTFNNDAEQRMEKKRKCDEARIAREVEANEIRIQKELERQDNLRRKNEERMRKEMEKHERERRKEEERLMRERQREEERSLREQKREMERREKFLQKEYLRAEKRRLKEELRMEKQAAKRKVAIEKATARKMAKESMDLIEDEQLELMDLAAASKGLSSIIHLDLETLQNLDSFRDSLSVFPPKTVRLKRPFSVQPWSDSEENVGNLLMVWRFFITFADVLGLWPFTLDEFVQAFHDHESRLLGEIHLALLKSIIKDIEDVARTPSTGLGMNQYCAANPEGGHPRIIEGAYAWGFDIRNWQQLLNPLTWHEIFRQLALSAGFGPKLKKRSSKWANVGDNHEGKGCEDIVSTIRNGSAAENAFAWMREKGLLLPRRSRHKLTPGTVKFAAFHVLSLEGSKGLTVLELADKIQKSGLRDLTTSKTPEASISVALTRDTKLFERIAPSTYCVRPAFRKDPADAEAILAAARKKIRIFENGFLGGEDADDVERDEDSECDVEEDPEVEDLATPSSANKNIDRYDEANTCLVSGKDNACNDVALSVQNEVDKGFSSFSLNDSKDARCQGTADNYVAVEDFGASHLNQENIEIDESKPGESWIQGLAEGDYSHLSVEERLNALVALIGIANEGNSIRAVLEDRLEAANALKKQMWAEAQLDKSRLKEENITKLDFTPAMGSKAETHLASSAAEGGQSPLPVFVDNKNEASPSLAEDQKPMFGSQVFQNHLSEFPNERTVAVQDPSTGLDNLATQQHGYASKRSRSQLKAYIAHMAEEMYVYRSLPLGQDRRRNRYWQFATSASRNDPCSGRIFVELHDGTWRLIDTVEAFDALLSSLDARGTRESHLRIMLQKIETSFKDKVRRNLQGIDTVGQSWTAIKNEAAEMDVDPDFASSDSPSSTVCGLNSDTLETSSSFRIELGRNEIEKKAALERFQDFQWWMWRECFNSLSLCASKNEKTRCRQLLVICDVCLDSYLCEDAHCPSCHRTFGAVDKSSKFSEHSIQCEEKTKLGLRDIHVSDSSLPLGIRLLKPLSAVIEAYIPPEALEASWTDERRKTWGMKLNMSSSAEEVLQLLTILESGIKRSYLSSNFETTKELLGSSFTCADPWSVPILPWIPKTTAAVALRLLELDASIMYVKPEKPEQFEEDKEANERVVSSYAISF
ccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHcccccccccccccccccccccccHHHHHHHccccHHHHHHccccccHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccHHHHHHHHcccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccHHHHHccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEcccccccccccccEEEEEccccEEEEccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHccccccccccccccccccccccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccHHcHHHHHHcccccccccccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHcccccccccccc
ccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccEEccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEccccHHcccHHHHHHccccccccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHHccccccccccHHHcccccccccccccHHHHHHHccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHccHHEEEccccEEEEcccccccHHHHHHHHHHHHHHHHHHHccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccEEcccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccccccccccccccccHcccccccccccccccccccccccccccccccHHcccccccccHHcccccccccccccccHHHHHHHHHHccHHHHHHHHHHcHHHcEEEEccccccccccccEEEEEcccccccccccEEEEEEccccEEEEccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHccccccccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccccccccccEcEcccccHHHHHHHHHHHHHHHHHHHHccccccccccHHcccccEEEEEEEcc
mevdsdaeksneCKKFVVnnnnnnhsnegqqgkpkrqmktpfQLETLEKAyasetypsestraELSEKLGLSDRQLQMWFCHRrlkdkkekenppkkmrknvavvmpespidelragaepgsdygsgsgsgsspyLMELRNAvgssrglmddmpivrrSYESQQSIMELRAIACVEAqlgeplredgpilgmefdslppdafgapigsseqqkrsghpyeskiydrydtksnkviprahheyqslsdqpyfhgspidgsrartsflhanepssrvhgvqGHVARVRVLsqqdkpahifsspnggedsllqrestsnnrknaqstshpifgtedpyllsdgqtfnNDAEQRMEKKRKCDEARIAREVEANEIRIQKELERQDNLRRKNEERMRKEMEKHERERRKEEERLMRERQREEERSLREQKREMERREKFLQKEYLRAEKRRLKEELRMEKQAAKRKVAIEKATARKMAKESMDLIEDEQLELMDLAAASKGLSSIIHLDLETLQNLDsfrdslsvfppktvrlkrpfsvqpwsdseenVGNLLMVWRFFITFADvlglwpftLDEFVQAFHDHESRLLGEIHLALLKSIIKDIEdvartpstglgmnqycaanpegghpriieGAYAWGFDIRNWQQLLNPLTWHEIFRQLALsagfgpklkkrsskwanvgdnhegkgceDIVSTIRNGSAAENAFAWMREKGlllprrsrhkltpgtvKFAAFHVLSlegskgltvLELADKIQKSglrdlttsktpeasiSVALTRDtklferiapstycvrpafrkdpADAEAILAAARKKIRIfengflggedaddverdedsecdveedpevedlatpssanknidrydeantclvsgkdnacndVALSVQNEVdkgfssfslndskdarcqgtadNYVAVEdfgashlnqenieideskpgeswiqglaegdyshlSVEERLNALVALIGIANEGNSIRAVLEDRLEAANALKKQMWAEAQLDKsrlkeenitkldftpamgskaethlassaaeggqsplpvfvdnkneaspslaedqkpmfgsqvFQNHlsefpnertvavqdpstgldnlatqqhgyaskrSRSQLKAYIAHMAEEMYVyrslplgqdrrrnRYWQfatsasrndpcsgriFVELHDGTWRLIDTVEAFDALLSSLDARGTRESHLRIMLQKIETSFKDKVRRNLQGIDTVGQSWTAIKNEaaemdvdpdfassdspsstvcglnsdtletsSSFRIELGRNEIEKKAALERFQDFQWWMWRECfnslslcasknektRCRQLLVICDVcldsylcedahcpschrtfgavdksskfsehsiqceektklglrdihvsdsslplgiRLLKPLSAVIeayippealeaswtderRKTWGMKLNMSSSAEEVLQLLTILESGIKRSYLSSNFETTKELlgssftcadpwsvpilpwipkTTAAVALRLLELDASimyvkpekpeqfeedkeANERVVSSYAISF
mevdsdaeksneckkfvvnnnnnnhsnegqqgkpkrqMKTPFQLETLEKAyasetypsestraELSEKLGLSDRQLQMWFCHRrlkdkkekenppkkmrknvavvmpesPIDELRAGaepgsdygsgsgsgsspyLMELRNAVGSsrglmddmpIVRRSYESQQSIMELRAIACVEAQLGEPLREDGPILGMEFDSLPPDAFGApigsseqqkrsghpyeskiydrydtKSNKVIPRAHHeyqslsdqpyfHGSPIDGSRARTSFLHANEpssrvhgvqGHVARVRVLSQQDKPahifsspnggedSLLQRESTSNnrknaqstshpifgtedpyLLSDGQTFNNDAEQRMEkkrkcdeariareveaneiriqkelerqdnlrrkneermrkemekhererrkeeerlmrerqreeerslreqkremerrekflqkeylraekrrlkeelrmekqaakrkvaIEKATARKMAKESMDLIEDEQLELMDLAAASKGLSSIIHLDLETLQNLDSFRDSLSvfppktvrlkrpfsvqpwsdsEENVGNLLMVWRFFITFADVLGLWPFTLDEFVQAFHDHESRLLGEIHLALLKSIIKDIEDVARTPSTGLGMNQYCAANPEGGHPRIIEGAYAWGFDIRNWQQLLNPLTWHEIFRQLALSAGFGPKLKKRSSKwanvgdnhegkgceDIVSTIRNGSAAENAFAWMREKGLLLPRRSRHKLTPGTVKFAAFHVLSlegskgltvLELADKIQksglrdlttsktpeasisvaltrdtklferiapstycvrpafrkdPADAEAILAAARKKIRIfengflggedaddverDEDSecdveedpevedlatpssanknidryDEANTCLVSGKDNACNDVALSVQNEVDKGFSsfslndskdarCQGTADNYVAVEDFGASHLNQENIEIDESKPGESWIQGLAEGDYSHLSVEERLNALVALIGIANEGNSIRAVLEDRLEAANALKKQMWAEaqldksrlkeenitkLDFTPAMGSKAETHLASSAAEGGQSPLPVFVDNKNEASPSLAEDQKPMFGSQVFQNHLSEFPNERTVAVQDPSTGLDNLATQqhgyaskrsrSQLKAYIAHMAEEMYVYRSLPLGQDRRRNRYWQfatsasrndpcsgrIFVELHDGTWRLIDTVEAFDALLSSldargtresHLRIMLQKIETSFKDKVRRNLQGIDTVGQSWTAIKNEAAEMDVDPDFASSDspsstvcglnsdtletsssfrieLGRNEIEKKAALERFQDFQWWMWRECFNSLSLCASKNEKTRCRQLLVICDVCLDSYLCEDAHCPSCHRTFGAVDKSSKFSEHSIQCeektklglrdihVSDSSLPLGIRLLKPLSAVIEAyippealeaswtdeRRKTWGMKLNMSSSAEEVLQLLTILESGIKRSYLSSNFETTKELLGSSFTCADPWSVPILPWIPKTTAAVALRLLELDASIMYVKpekpeqfeedkeanerVVSSYAISF
MEVDSDAEKSNECKKFVVnnnnnnHSNEGQQGKPKRQMKTPFQLETLEKAYASETYPSESTRAELSEKLGLSDRQLQMWFCHRRLkdkkekenppkkmrknVAVVMPESPIDELRAGAEPgsdygsgsgsgssPYLMELRNAVGSSRGLMDDMPIVRRSYESQQSIMELRAIACVEAQLGEPLREDGPILGMEFDSLPPDAFGAPIGSSEQQKRSGHPYESKIYDRYDTKSNKVIPRAHHEYQSLSDQPYFHGSPIDGSRARTSFLHANEPSSRVHGVQGHVARVRVLSQQDKPAHIFSSPNGGEDSLLQRESTSNNRKNAQSTSHPIFGTEDPYLLSDGQTFNNDAEQRMEKKRKCDEARIAREVEANEIRIQKELERQDNlrrkneermrkemekhererrkeeerlmrerqreeerslreqkremerrekFLQkeylraekrrlkeelrmekQAAKRKVAIEKATARKMAKESMDLIEDEQLELMDLAAASKGLSSIIHLDLETLQNLDSFRDSLSVFPPKTVRLKRPFSVQPWSDSEENVGNLLMVWRFFITFADVLGLWPFTLDEFVQAFHDHESRLLGEIHLALLKSIIKDIEDVARTPSTGLGMNQYCAANPEGGHPRIIEGAYAWGFDIRNWQQLLNPLTWHEIFRQLALSAGFGPKLKKRSSKWANVGDNHEGKGCEDIVSTIRNGSAAENAFAWMREKGLLLPRRSRHKLTPGTVKFAAFHVLSLEGSKGLTVLELADKIQKSGLRDLTTSKTPEASISVALTRDTKLFERIAPSTYCVRPAFRKDPadaeailaaaRKKIRIFENGFLGGEDAddverdedsecdveedpevedLATPSSANKNIDRYDEANTCLVSGKDNACNDVALSVQNEVDKGFSSFSLNDSKDARCQGTADNYVAVEDFGASHLNQENIEIDESKPGESWIQGLAEGDYSHLSVEERLNALVALIGIANEGNSIRAVLEDRLEAANALKKQMWAEAQLDKSRLKEENITKLDFTPAMGSKAETHLASSAAEGGQSPLPVFVDNKNEASPSLAEDQKPMFGSQVFQNHLSEFPNERTVAVQDPSTGLDNLATQQHGYASKRSRSQLKAYIAHMAEEMYVYRSLPLGQDRRRNRYWQFATSASRNDPCSGRIFVELHDGTWRLIDTVEAFDALLSSLDARGTRESHLRIMLQKIETSFKDKVRRNLQGIDTVGQSWTAIKNEAAEMdvdpdfassdspssTVCGLNSDTLETSSSFRIELGRNEIEKKAALERFQDFQWWMWRECFNSLSLCASKNEKTRCRQLLVICDVCLDSYLCEDAHCPSCHRTFGAVDKSSKFSEHSIQCEEKTKLGLRDIHVSDSSLPLGIRLLKPLSAVIEAYIPPEALEASWTDERRKTWGMKLNMSSSAEEVLQLLTILESGIKRSYLSSNFETTKELLGSSFTCADPWSVPILPWIPKTTAAVALRLLELDASIMYVKPEKPEQFEEDKEANERVVSSYAISF
**************************************************************************QLQMWFCHR**********************************************************************************IMELRAIACVEAQLG******************************************************************************************************************************************************************************************************************************************************************************************************************LMDLAAASKGLSSIIHLDLETLQNLDSFRDSLSVFPPKTVRLKRPFSVQPWSDSEENVGNLLMVWRFFITFADVLGLWPFTLDEFVQAFHDHESRLLGEIHLALLKSIIKDIEDVARTPSTGLGMNQYCAANPEGGHPRIIEGAYAWGFDIRNWQQLLNPLTWHEIFRQLALSAGFGPKLK****KWANVGDNHEGKGCEDIVSTIRNGSAAENAFAWMREKGLLLPRRSRHKLTPGTVKFAAFHVLSLEGSKGLTVLELADKIQ****************ISVALTRDTKLFERIAPSTYCVRPAFRKDPADAEAILAAARKKIRIFENGFLG*****************************************ANTCLVSGKDNACNDVALSVQNEV****************CQGTADNYVAVEDFGASHL**************SWIQGLAEGDYSHLSVEERLNALVALIGIANEGNSIRAVLEDRLEAANALKKQMW***************************************************************************************************************LKAYIAHMAEEMYVYRSLPLGQDRRRNRYWQFATSASRNDPCSGRIFVELHDGTWRLIDTVEAFDALLSSLDARGTRESHLRIMLQKIETSFKDKVRRNLQGIDTVGQSWTAI**************************************IELGRNEIEKKAALERFQDFQWWMWRECFNSLSLCASKNEKTRCRQLLVICDVCLDSYLCEDAHCPSCHRTFGAVDK********IQCEEKTKLGLRDIHVSDSSLPLGIRLLKPLSAVIEAYIPPEALEASWTDERRKTWGMKLNMS*SAEEVLQLLTILESGIKRSYLSSNFETTKELLGSSFTCADPWSVPILPWIPKTTAAVALRLLELDASIMYV**************************
**********************************************LEKAYASETYPS*************SDRQLQMWFC*****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************PFSVQPWSDSEENVGNLLMVWRFFITFADVLGLWPFTLDEFVQAFHDHESRLLGEIHLALLKSIIKDIEDVA******************GGHPRIIEGAYAWGFDIRNWQQLLNPLTWHEIFRQLALSAGFG***************NHEGKGCEDIVSTIRNGSAAENAFAWM*********RSRHKLTPGTVKFAAFHVLSLEGSKGLTVLELADK*****************SISVALTRDTKLFERIAPSTYCVRPA**********************************************************************************************************************************************SWIQGLAEGDYSHLSVEERLNALVALIGIANEGNSIRAVLEDRL************************************************************************************************************************************EMYVYRSLPLGQDRRRNRYWQFATSASRNDPCSGRIFVELHDGTWRLIDTVEAFDALLSSLDARGTRESHLRIMLQKIETSF***************************************************LETSSSFRIELGRNEIEKKAALERFQDFQWWMWRECFNSLSLCASKNEKTRCRQLLVICDVCLDSYLCEDAHCPSCHRTFGAVDKSSKFSEHSIQCEEKTKLGLRDIHVSDSSLPLGIRLLKPLSAVIEAYIPPEALEASWTDERRKTWGMKLNMSSSAEEVLQLLTILESGIKRSYLSSNFETTKELLGSSFTCADPWSVPILPWIPKTTAAVALRLLELDASIM*********************SSYA*S*
***********ECKKFVVNNNNNNHS***********MKTPFQLETLEKAYAS************SEKLGLSDRQLQMWFCHRRLKDKKEKENPPKKMRKNVAVVMPESPIDELRAGA************GSSPYLMELRNAVGSSRGLMDDMPIVRRSYESQQSIMELRAIACVEAQLGEPLREDGPILGMEFDSLPPDAFGAPI************YESKIYDRYDTKSNKVIPRAHHEYQSLSDQPYFHGSPIDGSRARTSFLHANEPSSRVHGVQGHVARVRVLSQQDKPAHIFSSPNGGEDS*****************SHPIFGTEDPYLLSDGQTFNND***********DEARIAREVEANEIRIQKELERQDNLRRKNE****************************************ERREKFLQKEYLRAEKRRLKEEL***********AIEKATARKMAKESMDLIEDEQLELMDLAAASKGLSSIIHLDLETLQNLDSFRDSLSVFPPKTVRLKRPFSVQPWSDSEENVGNLLMVWRFFITFADVLGLWPFTLDEFVQAFHDHESRLLGEIHLALLKSIIKDIEDVARTPSTGLGMNQYCAANPEGGHPRIIEGAYAWGFDIRNWQQLLNPLTWHEIFRQLALSAGFGP**************NHEGKGCEDIVSTIRNGSAAENAFAWMREKGLLLPRRSRHKLTPGTVKFAAFHVLSLEGSKGLTVLELADKIQKSGLRDLTTSKTPEASISVALTRDTKLFERIAPSTYCVRPAFRKDPADAEAILAAARKKIRIFENGFLGGEDAD**********************TPSSANKNIDRYDEANTCLVSGKDNACNDVALSVQNEVDKGFSSFSLNDSKDARCQGTADNYVAVEDFGASHLNQENIEIDESKPGESWIQGLAEGDYSHLSVEERLNALVALIGIANEGNSIRAVLEDRLEAANALKKQMWAEAQLDKSRLKEENITKLDFTPAMGSK************GQSPLPVFVDNKNEASPSLAEDQKPMFGSQVFQNHLSEFPNERTVAVQDPSTGLDNLATQQHGYASKRSRSQLKAYIAHMAEEMYVYRSLPLGQDRRRNRYWQFATSASRNDPCSGRIFVELHDGTWRLIDTVEAFDALLSSLDARGTRESHLRIMLQKIETSFKDKVRRNLQGIDTVGQSWTAIKNEAAEMDVDPD************GLNSDTLETSSSFRIELGRNEIEKKAALERFQDFQWWMWRECFNSLSLCASKNEKTRCRQLLVICDVCLDSYLCEDAHCPSCHRTFGAV***********QCEEKTKLGLRDIHVSDSSLPLGIRLLKPLSAVIEAYIPPEALEASWTDERRKTWGMKLNMSSSAEEVLQLLTILESGIKRSYLSSNFETTKELLGSSFTCADPWSVPILPWIPKTTAAVALRLLELDASIMYVKPEK**************VSSYAISF
***********************************RQMKTPFQLETLEKAYASETYPSESTRAELSEKLGLSDRQLQMWFCHRRLKDKK*****************************************************************IVRRSYESQQSIMELRAIACVEAQLGEPLREDGPILGMEFDSLPPDAFGAPIG**********PY**K**D*Y*TKSNKVIPRAHHEYQSLSDQPYFHGSPIDGSRARTSF*HA**PSSRV**V**HVARVRVLS***KP*HI*****GGEDSLLQRESTSNN*KN*QSTSHPIFGTEDPYLLS*****NND**QRMEKKRKCDEARIAREVEANEIRIQKELERQDNLRRKN**********************MRER****ERSLREQKREMERREKFLQKEYLRAEKRR**EELRMEKQAAKRKVAIEKATARKMAKESMDLIEDEQLELMDLAAASKGLSSIIHLDLETLQNLDSFRDSLSVFPPKTVRLKRPFSVQPWSDSEENVGNLLMVWRFFITFADVLGLWPFTLDEFVQAFHDHESRLLGEIHLALLKSIIKDIEDVARTPSTGLGMNQYCAANPEGGHPRIIEGAYAWGFDIRNWQQLLNPLTWHEIFRQLALSAGFGPKLKKRSSKWANVGDNHEGKGCEDIVSTIRNGSAAENAFAWMREKGLLLPRRSRHKLTPGTVKFAAFHVLSLEGSKGLTVLELADKIQKSGLRDLTTSKTPEASISVALTRDTKLFERIAPSTYCVRPAFRKDPADAEAILAAARKKIRIFENGF********************************************************************************************************ENIEIDESKPGESWIQGLAEGDYSHLSVEERLNALVALIGIANEGNSIRAVLEDRLEAANALKKQMWAEAQLDKSR****N*TKLDF*********************************************************************************GYASKRSRSQLKAYIAHMAEEMYVYRSLPLGQDRRRNRYWQFATSASRNDPCSGRIFVELHDGTWRLIDTVEAFDALLSSLDARGTRESHLRIMLQKIETSFKDKVRRNLQGID*V**************************************ETSSSFRIELGRNEIEKKAALERFQDFQWWMWRECFNSLSLCASKNEKTRCRQLLVICDVCLDSYLCEDAHCPSCHRTFGAVDKSSKFSEHSIQCEEKTKLGLRDIHVSDSSLPLGIRLLKPLSAVIEAYIPPEALEASWTDERRKTWGMKLNMSSSAEEVLQLLTILESGIKRSYLSSNFETTKELLGSSFTCADPWSVPILPWIPKTTAAVALRLLELDASIMYVKPEKP*QFEEDKEANERVVSSYAISF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVDSDAEKSNECKKFVVNNNNNNHSNEGQQGKPKRQMKTPFQLETLEKAYASETYPSESTRAELSEKLGLSDRQLQMWFCHRRLKDKKEKENPPKKMRKNVAVVMPESPIDELRAGAEPGSDYGSGSGSGSSPYLMELRNAVGSSRGLMDDMPIVRRSYESQQSIMELRAIACVEAQLGEPLREDGPILGMEFDSLPPDAFGAPIGSSEQQKRSGHPYESKIYDRYDTKSNKVIPRAHHEYQSLSDQPYFHGSPIDGSRARTSFLHANEPSSRVHGVQGHVARVRVLSQQDKPAHIFSSPNGGEDSLLQRESTSNNRKNAQSTSHPIFGTEDPYLLSDGQTFNNDAEQRMEKKRKCDEARIARExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxARKMAKESMDLIEDEQLELMDLAAASKGLSSIIHLDLETLQNLDSFRDSLSVFPPKTVRLKRPFSVQPWSDSEENVGNLLMVWRFFITFADVLGLWPFTLDEFVQAFHDHESRLLGEIHLALLKSIIKDIEDVARTPSTGLGMNQYCAANPEGGHPRIIEGAYAWGFDIRNWQQLLNPLTWHEIFRQLALSAGFGPKLKKRSSKWANVGDNHEGKGCEDIVSTIRNGSAAENAFAWMREKGLLLPRRSRHKLTPGTVKFAAFHVLSLEGSKGLTVLELADKIQKSGLRDLTTSKTPEASISVALTRDTKLFERIAPSTYCVRPAFRKDPADAEAILAAARKKIRIFENGFLGGEDADDVERDEDSECDVEEDPEVEDLATPSSANKNIDRYDEANTCLVSGKDNACNDVALSVQNEVDKGFSSFSLNDSKDARCQGTADNYVAVEDFGASHLNQENIEIDESKPGESWIQGLAEGDYSHLSVEERLNALVALIGIANEGNSIRAVLEDRLEAANALKKQMWAEAQLDKSRLKEENITKLDFTPAMGSKAETHLASSAAEGGQSPLPVFVDNKNEASPSLAEDQKPMFGSQVFQNHLSEFPNERTVAVQDPSTGLDNLATQQHGYASKRSRSQLKAYIAHMAEEMYVYRSLPLGQDRRRNRYWQFATSASRNDPCSGRIFVELHDGTWRLIDTVEAFDALLSSLDARGTRESHLRIMLQKIETSFKDKVRRNLQGIDTVGQSWTAIKNEAAEMDVDPDFASSDSPSSTVCGLNSDTLETSSSFRIELGRNEIEKKAALERFQDFQWWMWRECFNSLSLCASKNEKTRCRQLLVICDVCLDSYLCEDAHCPSCHRTFGAVDKSSKFSEHSIQCEEKTKLGLRDIHVSDSSLPLGIRLLKPLSAVIEAYIPPEALEASWTDERRKTWGMKLNMSSSAEEVLQLLTILESGIKRSYLSSNFETTKELLGSSFTCADPWSVPILPWIPKTTAAVALRLLELDASIMYVKPEKPEQFEEDKEANERVVSSYAISF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1497 2.2.26 [Sep-21-2011]
Q06453408 Homeobox protein aristale yes no 0.062 0.230 0.318 8e-07
P20269134 Homeobox protein ceh-5 OS yes no 0.037 0.417 0.516 2e-06
Q90476405 LIM/homeobox protein Lhx1 no no 0.057 0.212 0.356 3e-06
Q1KKT1265 Homeobox protein Hox-D11a N/A no 0.046 0.260 0.376 8e-06
Q9DDU0284 Homeobox protein Hox-A11a no no 0.042 0.225 0.406 1e-05
P31258297 Homeobox protein Hox-A11 yes no 0.042 0.215 0.390 3e-05
Q1KL17283 Homeobox protein Hox-A11a N/A no 0.057 0.303 0.325 8e-05
>sp|Q06453|AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster GN=al PE=1 SV=2 Back     alignment and function desciption
 Score = 57.4 bits (137), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 59/113 (52%), Gaps = 19/113 (16%)

Query: 21  NNNNHSNEGQQGKPKRQMK------TPFQLETLEKAYASETYPSESTRAELSEKLGLSDR 74
           ++ N   E  +  PKR+ +      T FQLE LEKA++   YP   TR EL+ K+GL++ 
Sbjct: 68  SDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEA 127

Query: 75  QLQMWFCHRRLKDKKEKENPPKK-------------MRKNVAVVMPESPIDEL 114
           ++Q+WF +RR K +K+++  P+              M+  V   +P +P   L
Sbjct: 128 RIQVWFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPPNPFTHL 180




Involved in the morphogenesis of proximal and distal pattern elements in a subset of appendages. Also has a role in early imaginal disk development.
Drosophila melanogaster (taxid: 7227)
>sp|P20269|HM05_CAEEL Homeobox protein ceh-5 OS=Caenorhabditis elegans GN=ceh-5 PE=4 SV=4 Back     alignment and function description
>sp|Q90476|LHX1_DANRE LIM/homeobox protein Lhx1 OS=Danio rerio GN=lhx1a PE=2 SV=1 Back     alignment and function description
>sp|Q1KKT1|HXDBA_TAKRU Homeobox protein Hox-D11a OS=Takifugu rubripes GN=hoxd11a PE=3 SV=1 Back     alignment and function description
>sp|Q9DDU0|HXABA_DANRE Homeobox protein Hox-A11a OS=Danio rerio GN=hoxa11a PE=2 SV=1 Back     alignment and function description
>sp|P31258|HXA11_CHICK Homeobox protein Hox-A11 OS=Gallus gallus GN=HOXA11 PE=2 SV=1 Back     alignment and function description
>sp|Q1KL17|HXABA_TAKRU Homeobox protein Hox-A11a OS=Takifugu rubripes GN=hoxa11a PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1497
255536725 1732 homeobox protein, putative [Ricinus comm 0.947 0.819 0.677 0.0
2241255781423 predicted protein [Populus trichocarpa] 0.933 0.981 0.659 0.0
2240770581440 predicted protein [Populus trichocarpa] 0.946 0.984 0.673 0.0
359483496 1729 PREDICTED: uncharacterized protein LOC10 0.966 0.836 0.646 0.0
449479573 1750 PREDICTED: uncharacterized protein LOC10 0.958 0.82 0.635 0.0
297740429 1682 unnamed protein product [Vitis vinifera] 0.936 0.833 0.635 0.0
356546621 1755 PREDICTED: uncharacterized protein LOC10 0.957 0.816 0.632 0.0
357446737 1796 Homeobox protein Hox-C4 [Medicago trunca 0.957 0.797 0.612 0.0
124360728 1795 DDT; Homeodomain-related [Medicago trunc 0.957 0.798 0.612 0.0
225446457 1772 PREDICTED: uncharacterized protein LOC10 0.973 0.822 0.596 0.0
>gi|255536725|ref|XP_002509429.1| homeobox protein, putative [Ricinus communis] gi|223549328|gb|EEF50816.1| homeobox protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1894 bits (4905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1003/1480 (67%), Positives = 1171/1480 (79%), Gaps = 61/1480 (4%)

Query: 31   QGKPKRQMKTPFQLETLEKAYASETYPSESTRAELSEKLGLSDRQLQMWFCHRRLKDKKE 90
            Q +PKRQMKTPFQLE LEKAYA +TYPSE  RAELS++L L+DRQLQMWFCHRRLKDK +
Sbjct: 27   QSRPKRQMKTPFQLEALEKAYALDTYPSEKVRAELSQRLNLTDRQLQMWFCHRRLKDKDK 86

Query: 91   KE----NPPKKMRKNVAVVMPESPIDELRAGA-EPGSDYGSGSGSGSSPYLMELRNAVGS 145
            KE     P  + RK  AV + ESP++E+RA   EPGSD GSGSGSGSSP+ M+ R  V +
Sbjct: 87   KEEKKETPSNRKRK--AVHLSESPVEEMRAIIPEPGSDDGSGSGSGSSPF-MDPRKVVSA 143

Query: 146  SRGLMDDMPIVRRSYESQ-QSIMELRAIACVEAQLGEPLREDGPILGMEFDSLPPDAFGA 204
                  D+P+ RR YES  QS+MELRAIACVEAQLGEPLR+DGPILGMEFD LPPDAFG 
Sbjct: 144  ------DVPMNRRYYESSPQSVMELRAIACVEAQLGEPLRDDGPILGMEFDPLPPDAFGE 197

Query: 205  PIGSSEQQKRSGHPYESKIYDRYDTKSNKVIPRAHHEYQSLSDQ--------------PY 250
            PI   EQQKRS H Y+ K+Y+R++TKS+K   R  HEYQ L DQ              PY
Sbjct: 198  PISMVEQQKRSAHSYDGKVYERHNTKSSKAFARVFHEYQFLPDQSSIRSDAYGQVAQSPY 257

Query: 251  FHGSPIDGSRARTSFLHANEPSSRVHGVQGHVARVRVLSQQDKPAHIFSSPNGGEDSLLQ 310
             H SP+D  R R S +  +EP SR HGVQG  +RVR+ SQ +K  H+FSSP   +D LLQ
Sbjct: 258  -HDSPVDNLRGRASLVLGDEPLSRGHGVQG--SRVRLFSQPEKKGHVFSSPRRDDDYLLQ 314

Query: 311  RESTSNNRKNAQSTSHPIFGTEDPYLLSDGQTFNNDAEQRMEKKRKCDEARIAREVEANE 370
             +S +NNR +AQ++SHPI G+E+P   SD Q  + + +  MEKKRK DEAR  R+ EANE
Sbjct: 315  HDSYTNNRISAQTSSHPIMGSENPDGFSDAQILHTETDVWMEKKRKIDEARTVRDPEANE 374

Query: 371  IRIQKELERQDNLRRKNEERMRKEMEKHERERRKEEERLMRERQREEERSLREQKREMER 430
             RI+KELE++D LRRKNEER++K+ME+ +RERRKEEERLMRERQREEERSLREQKRE+ER
Sbjct: 375  YRIRKELEKKDQLRRKNEERIKKDMERQDRERRKEEERLMRERQREEERSLREQKRELER 434

Query: 431  REKFLQKEYLRAEKRRLKEELRMEKQAAKRKVAIEKATARKMAKESMDLIEDEQLELMDL 490
            REKFLQKEYLRAEK R KEELR EK+A KR+ AIEKATAR++AKES+DLIEDEQLELM++
Sbjct: 435  REKFLQKEYLRAEKMRQKEELRKEKEAVKRQAAIEKATARRIAKESLDLIEDEQLELMEI 494

Query: 491  AAASKGLSSIIHLDLETLQNLDSFRDSLSVFPPKTVRLKRPFSVQPWSDSEENVGNLLMV 550
            A ASKGL+SI+HL+ + LQ+L+SFRDSLS+FPP++V+L +PF++QPW DSEEN+GNLLMV
Sbjct: 495  AVASKGLASIVHLNYDALQSLESFRDSLSMFPPQSVQLTKPFAIQPWMDSEENIGNLLMV 554

Query: 551  WRFFITFADVLGLWPFTLDEFVQAFHDHESRLLGEIHLALLKSIIKDIEDVARTPSTGLG 610
            WRFFITFADV+GLWPFTLDEFVQAFHD++SRLLGE+H++LL+ IIKDIEDVARTPS GLG
Sbjct: 555  WRFFITFADVIGLWPFTLDEFVQAFHDYDSRLLGEVHVSLLRLIIKDIEDVARTPSIGLG 614

Query: 611  MNQYCAANPEGGHPRIIEGAYAWGFDIRNWQQLLNPLTWHEIFRQLALSAGFGPKLKKRS 670
             NQY  ANPEGGHP+I+EGAY WGFDIRNWQ+ LNP+TW EIFRQLALSAGFGP+LKK+ 
Sbjct: 615  TNQYSPANPEGGHPQIVEGAYMWGFDIRNWQRHLNPVTWPEIFRQLALSAGFGPRLKKKG 674

Query: 671  SKWANVGDNHEGKGCEDIVSTIRNGSAAENAFAWMREKGLLLPRRSRHKLTPGTVKFAAF 730
            + W  +GDN E KGCED +ST+RNGSAAENAFA MRE+GLLLPRRSRH+LTPGTVKFAAF
Sbjct: 675  TAWTYLGDNDEVKGCEDTISTLRNGSAAENAFALMRERGLLLPRRSRHRLTPGTVKFAAF 734

Query: 731  HVLSLEGSKGLTVLELADKIQKSGLRDLTTSKTPEASISVALTRDTKLFERIAPSTYCVR 790
            HVLSLEGSKGLTVLELADKIQKSGLRDLTTSKTPEASISVALTRD KLFERIAPSTYC+R
Sbjct: 735  HVLSLEGSKGLTVLELADKIQKSGLRDLTTSKTPEASISVALTRDQKLFERIAPSTYCLR 794

Query: 791  PAFRKDPADAEAILAAARKKIRIFENGFLGGEDADDVERDEDSECDVEEDPEVEDLATPS 850
             A+RKDPADAEAIL+AARKKIRIFENGFLGG+DADDVERDE+SE DVEEDPEV+DLATP 
Sbjct: 795  AAYRKDPADAEAILSAARKKIRIFENGFLGGDDADDVERDEESEGDVEEDPEVDDLATPL 854

Query: 851  SANKNIDRYDEANTCLVSGKDNACNDVALSVQNEVDKGFSSFSLNDSKDARCQGTADNYV 910
            +ANK+    +EANTC  SGKDN C+ V LS++NE+ K  SS   N  KDA+         
Sbjct: 855  TANKSAVHSNEANTCSGSGKDNVCSGVPLSIKNELVKEPSSVPSNGLKDAKTPSI--EQC 912

Query: 911  AVEDFGASHLNQENIEIDESKPGESWIQGLAEGDYSHLSVEERLNALVALIGIANEGNSI 970
              +D  A+++++ENIEIDESK GESWIQGLAE +Y+HLSVEERLNALVAL+GIANEGN+I
Sbjct: 913  VAQDVVAANIDEENIEIDESKSGESWIQGLAEAEYAHLSVEERLNALVALVGIANEGNTI 972

Query: 971  RAVLEDRLEAANALKKQMWAEAQLDKSRLKEENITKLDFTPAMGSKAETHLASSAAEGGQ 1030
            R+VLEDRLEAANALKKQMWAEAQLD+SRLKE+ ++KLDF+ ++G +AE  +ASSA EG Q
Sbjct: 973  RSVLEDRLEAANALKKQMWAEAQLDRSRLKEDIMSKLDFSSSIGVRAELQVASSAVEGSQ 1032

Query: 1031 SPLPVFVDNKN-EASPSLAEDQKPMFGSQVFQNHLSEFPNERTVAVQDPSTGLDNLATQQ 1089
            SPL + VD+K+ EASPS  EDQK +  S+         P E+ + VQDPS+  DN ++QQ
Sbjct: 1033 SPL-LLVDSKSKEASPSTGEDQKSLLASE-------SVPTEKQLVVQDPSSNPDNFSSQQ 1084

Query: 1090 HGYASKRSRSQLKAYIAHMAEEMYVYRSLPLGQDRRRNRYWQFATSASRNDPCSGRIFVE 1149
            HGY SKRSRSQLKAYI H+AEE YVYRSLPLGQDRRRNRYWQF  SAS+NDPCSG IFVE
Sbjct: 1085 HGYGSKRSRSQLKAYIGHIAEETYVYRSLPLGQDRRRNRYWQFVASASKNDPCSGWIFVE 1144

Query: 1150 LHDGTWRLIDTVEAFDALLSSLDARGTRESHLRIMLQKIETSFKDKVRRNLQGIDTVGQS 1209
            LHDG WRLID+ EAFDALLSSLD RG RESHLRIMLQK+E SFKD +RRNL    T    
Sbjct: 1145 LHDGNWRLIDSEEAFDALLSSLDTRGVRESHLRIMLQKVEKSFKDNIRRNLHSRATA--- 1201

Query: 1210 WTAIKNEAAEMDVDPDF-ASSDSPSSTVCGLNSDTLETSSSFRIELGRNEIEKKAALERF 1268
                + EA E D      A   SP+S VCG N DT  TSS FRIELGRNE+EKK AL+R+
Sbjct: 1202 ----ETEACEADSSSICSAGYGSPTSMVCGSNLDTSNTSSLFRIELGRNEMEKKGALKRY 1257

Query: 1269 QDFQWWMWRECFNSLSLCASKNEKTRCRQLLVICDVCLDSYLCEDAHCPSCHRTFGAVDK 1328
            QDFQ WMW+ECFNSL+LCA K  K RC QLL  C+ C DSYL ED HC SCH+TF   +K
Sbjct: 1258 QDFQKWMWKECFNSLTLCAMKYGKKRCIQLLATCEWCFDSYLAEDTHCLSCHQTFSTANK 1317

Query: 1329 SSKFSEHSIQCEEKTKLGLRDIHVSDSSLPLGIRLLKPLSAVIEAYIPPEALEASWTDER 1388
            S    EH +QC++KTKL   D  V DSSLP GIR LK L ++IE  +P EALE+ WT+  
Sbjct: 1318 SFNIFEHEVQCKDKTKL---DHGVCDSSLPPGIRSLKALLSLIEVSVPAEALESFWTENH 1374

Query: 1389 RKTWGMKLNMSSSAEEVLQLLTILESGIKRSYLSSNFETTKELLGSSFTC-------ADP 1441
            RKTW MKLN SSS EE+LQ+LT+LES IKR  LS+NFE TKE  G S          AD 
Sbjct: 1375 RKTWAMKLNKSSSTEELLQMLTVLESAIKRDCLSANFEMTKEFSGGSILSHSALHSRADL 1434

Query: 1442 WSVPILPWIPKTTAAVALRLLELDASIMYVKPEKPEQFEE 1481
             SVP+LPWIPKTTAAVALRL +LDASI Y++ EK E  E+
Sbjct: 1435 RSVPVLPWIPKTTAAVALRLFDLDASIAYIQREKAEPSED 1474




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224125578|ref|XP_002329839.1| predicted protein [Populus trichocarpa] gi|222870901|gb|EEF08032.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224077058|ref|XP_002305113.1| predicted protein [Populus trichocarpa] gi|222848077|gb|EEE85624.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359483496|ref|XP_002273559.2| PREDICTED: uncharacterized protein LOC100247033 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449479573|ref|XP_004155639.1| PREDICTED: uncharacterized protein LOC101230914 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297740429|emb|CBI30611.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356546621|ref|XP_003541723.1| PREDICTED: uncharacterized protein LOC100777465 [Glycine max] Back     alignment and taxonomy information
>gi|357446737|ref|XP_003593644.1| Homeobox protein Hox-C4 [Medicago truncatula] gi|355482692|gb|AES63895.1| Homeobox protein Hox-C4 [Medicago truncatula] Back     alignment and taxonomy information
>gi|124360728|gb|ABN08705.1| DDT; Homeodomain-related [Medicago truncatula] Back     alignment and taxonomy information
>gi|225446457|ref|XP_002275272.1| PREDICTED: uncharacterized protein LOC100250601 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1497
TAIR|locus:2032505 1705 HB-1 "homeobox-1" [Arabidopsis 0.389 0.341 0.626 2.1e-299
TAIR|locus:2167628 1694 RLT2 "RINGLET 2" [Arabidopsis 0.376 0.332 0.547 4.7e-259
TAIR|locus:2159537723 AT5G08630 "AT5G08630" [Arabido 0.155 0.322 0.259 4.1e-12
DICTYBASE|DDB_G0282237885 DDB_G0282237 "DDT domain-conta 0.054 0.092 0.349 7.7e-10
WB|WBGene00000430134 ceh-5 [Caenorhabditis elegans 0.034 0.380 0.509 2.4e-06
MGI|MGI:1353499 1479 Baz1b "bromodomain adjacent to 0.133 0.135 0.230 7.6e-05
RGD|1595784108 Hoxc9 "homeobox C9" [Rattus no 0.033 0.462 0.38 0.0001
UNIPROTKB|P18866108 Hoxc8 "Homeobox protein Hox-C8 0.033 0.462 0.38 0.0001
UNIPROTKB|G3V661 1476 Baz1b "Bromodomain adjacent to 0.134 0.136 0.237 0.00018
UNIPROTKB|F1P4U7109 HOXD11 "Homeobox protein Hox-D 0.037 0.513 0.357 0.0002
TAIR|locus:2032505 HB-1 "homeobox-1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1816 (644.3 bits), Expect = 2.1e-299, Sum P(5) = 2.1e-299
 Identities = 375/599 (62%), Positives = 441/599 (73%)

Query:   457 AAKRKVAIEKATARKMAKESMDLIEDEQLELMDLAAASKGLSSIIHLDLETLQNLDSFRD 516
             A +RK+AIEKATAR++AKESMDLIEDEQLELM+LAA SKGL S++ LD +TLQNL+ +RD
Sbjct:   465 AIRRKLAIEKATARRIAKESMDLIEDEQLELMELAAISKGLPSVLQLDHDTLQNLEVYRD 524

Query:   517 SLSVFPPKTVRLKRPFSVQPWSDSEENVGNLLMVWRFFITFADVLGLWPFTLDEFVQAFH 576
             SLS FPPK+++LK PF++ PW DS+E VGNLLMVWRF I+F+DVL LWPFTLDEF+QAFH
Sbjct:   525 SLSTFPPKSLQLKMPFAISPWKDSDETVGNLLMVWRFLISFSDVLDLWPFTLDEFIQAFH 584

Query:   577 DHESRLLGEIHLALLKSIIKDIEDVARTPSTGLGMNQYCAANPEGGHPRIIEGAYAWGFD 636
             D++SRLLGEIH+ LL+SII+D+EDVARTP +G+G NQY  ANPEGGHP+I+EGAYAWGFD
Sbjct:   585 DYDSRLLGEIHVTLLRSIIRDVEDVARTPFSGIGNNQYTTANPEGGHPQIVEGAYAWGFD 644

Query:   637 IRNWQQLLNPLTWHEIFRQLALSAGFGPKLKKRSSKWANVGDNHEGKGCEDIVSTIRNGS 696
             IR+W++ LNPLTW EI RQLALSAGFGPKLKK+ S+  N GD  E KGCED++STIRNG+
Sbjct:   645 IRSWKKHLNPLTWPEILRQLALSAGFGPKLKKKHSRLTNTGDKDEAKGCEDVISTIRNGT 704

Query:   697 AAENAFAWMREKGLLLPRRSRHKLTPGTVKFAAFHVLSLEGSKGLTVLELADKIQKSGLR 756
             AAE+AFA MREKGLL PR+SRH+LTPGTVKFAAFHVLSLEGSKGLTVLELADKIQKSGLR
Sbjct:   705 AAESAFASMREKGLLAPRKSRHRLTPGTVKFAAFHVLSLEGSKGLTVLELADKIQKSGLR 764

Query:   757 DLTTSKTPEASISVALTRDTKLFERIAPSTYCVRPAFRKDPXXXXXXXXXXRKKIRIFEN 816
             DLTTSKTPEASISVALTRD KLFERIAPSTYCVR  + KDP          RKKIR FEN
Sbjct:   765 DLTTSKTPEASISVALTRDVKLFERIAPSTYCVRAPYVKDPKDGEAILADARKKIRAFEN 824

Query:   817 GFLGGEDAXXXXXXXXXXXXXXXXXXXXXLATPSSANKNIDRYDEANTCLVSGKDNACND 876
             GF G ED                      LAT +SA+K+     EAN     G D    D
Sbjct:   825 GFTGPEDVNDLERDEDFEIDIDEDPEVDDLATLASASKSAV-LGEANVLSGKGVDTMFCD 883

Query:   877 VALSVQNEVDKGFSSFSLNDSKDARCQGTADNYVAVEDFGASHLNQENIEIDESKPGESW 936
             V   V++E++K FSS   +  K    Q +  +   V   G   +      IDES  G+SW
Sbjct:   884 VKADVKSELEKEFSSPPPSTMKSIVPQHSERHKNTVVG-GVDAV------IDESNQGQSW 936

Query:   937 IQGLAEGDYSHLSVEERLNALVALIGIANEGNSIRAVLEDRLEAANALKKQMWAEAQLDK 996
             IQGL EGDY HLSVEERLNALVAL+GIANEGNSIR  LEDR+EAANALKKQMWAEAQLD 
Sbjct:   937 IQGLTEGDYCHLSVEERLNALVALVGIANEGNSIRTGLEDRMEAANALKKQMWAEAQLDN 996

Query:   997 SRLKEENITKLDFTPAMGSKAETHLASSAAEGGQSPLPVFVDNKNEASPS-LAEDQKPM 1054
             S +++  + KLD      SK E+ +     +        F     +  PS L ++ KP+
Sbjct:   997 SCMRD--VLKLDLQNLASSKTESTIGLPIIQSSTRERDSF-----DRDPSQLLDETKPL 1048


GO:0005634 "nucleus" evidence=ISM;ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009630 "gravitropism" evidence=RCA
GO:0005515 "protein binding" evidence=IPI
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=IGI
TAIR|locus:2167628 RLT2 "RINGLET 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159537 AT5G08630 "AT5G08630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282237 DDB_G0282237 "DDT domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00000430 ceh-5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
MGI|MGI:1353499 Baz1b "bromodomain adjacent to zinc finger domain, 1B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1595784 Hoxc9 "homeobox C9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P18866 Hoxc8 "Homeobox protein Hox-C8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V661 Baz1b "Bromodomain adjacent to zinc finger domain protein 1B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1P4U7 HOXD11 "Homeobox protein Hox-D11" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1497
pfam0279161 pfam02791, DDT, DDT domain 3e-23
pfam0004657 pfam00046, Homeobox, Homeobox domain 1e-17
smart0057163 smart00571, DDT, domain in different transcription 2e-16
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 1e-14
smart0038957 smart00389, HOX, Homeodomain 3e-14
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-10
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 4e-09
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 6e-09
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 7e-08
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 7e-08
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-07
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-07
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-07
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-07
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 2e-07
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 3e-07
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 4e-07
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-06
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-06
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 2e-06
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-06
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-06
pfam05672171 pfam05672, MAP7, MAP7 (E-MAP-115) family 3e-06
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 4e-06
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 7e-06
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-05
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-05
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 1e-05
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-05
TIGR03319514 TIGR03319, RNase_Y, ribonuclease Y 2e-05
pfam02841297 pfam02841, GBP_C, Guanylate-binding protein, C-ter 2e-05
PRK12704520 PRK12704, PRK12704, phosphodiesterase; Provisional 3e-05
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-05
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 4e-05
pfam12474142 pfam12474, PKK, Polo kinase kinase 4e-05
pfam12037276 pfam12037, DUF3523, Domain of unknown function (DU 5e-05
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-05
COG3064387 COG3064, TolA, Membrane protein involved in colici 6e-05
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 8e-05
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 9e-05
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 9e-05
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-04
COG2433652 COG2433, COG2433, Uncharacterized conserved protei 1e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 2e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
TIGR00570309 TIGR00570, cdk7, CDK-activating kinase assembly fa 2e-04
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-04
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
pfam12072201 pfam12072, DUF3552, Domain of unknown function (DU 3e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-04
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 4e-04
pfam09756189 pfam09756, DDRGK, DDRGK domain 5e-04
pfam09726680 pfam09726, Macoilin, Transmembrane protein 5e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-04
COG0711161 COG0711, AtpF, F0F1-type ATP synthase, subunit b [ 6e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 7e-04
pfam05672171 pfam05672, MAP7, MAP7 (E-MAP-115) family 7e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-04
pfam02841297 pfam02841, GBP_C, Guanylate-binding protein, C-ter 7e-04
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase 7e-04
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 8e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-04
COG3064387 COG3064, TolA, Membrane protein involved in colici 8e-04
COG2433652 COG2433, COG2433, Uncharacterized conserved protei 8e-04
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 8e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.001
pfam02841297 pfam02841, GBP_C, Guanylate-binding protein, C-ter 0.001
PRK12704520 PRK12704, PRK12704, phosphodiesterase; Provisional 0.001
PRK12704520 PRK12704, PRK12704, phosphodiesterase; Provisional 0.001
pfam12037276 pfam12037, DUF3523, Domain of unknown function (DU 0.001
COG1842225 COG1842, PspA, Phage shock protein A (IM30), suppr 0.001
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 0.001
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 0.001
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 0.001
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 0.001
TIGR02794346 TIGR02794, tolA_full, TolA protein 0.001
COG2268548 COG2268, COG2268, Uncharacterized protein conserve 0.001
pfam00769244 pfam00769, ERM, Ezrin/radixin/moesin family 0.001
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 0.001
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 0.002
TIGR03319514 TIGR03319, RNase_Y, ribonuclease Y 0.002
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.002
pfam09756189 pfam09756, DDRGK, DDRGK domain 0.002
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase 0.002
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 0.002
TIGR02794346 TIGR02794, tolA_full, TolA protein 0.002
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 0.002
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.003
pfam12037276 pfam12037, DUF3523, Domain of unknown function (DU 0.003
COG3064387 COG3064, TolA, Membrane protein involved in colici 0.003
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 0.003
pfam13904261 pfam13904, DUF4207, Domain of unknown function (DU 0.003
PRK05035695 PRK05035, PRK05035, electron transport complex pro 0.003
COG4487438 COG4487, COG4487, Uncharacterized protein conserve 0.003
pfam13863126 pfam13863, DUF4200, Domain of unknown function (DU 0.003
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
pfam12474142 pfam12474, PKK, Polo kinase kinase 0.004
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.004
pfam121281198 pfam12128, DUF3584, Protein of unknown function (D 0.004
COG1390194 COG1390, NtpE, Archaeal/vacuolar-type H+-ATPase su 0.004
>gnl|CDD|202398 pfam02791, DDT, DDT domain Back     alignment and domain information
 Score = 93.8 bits (234), Expect = 3e-23
 Identities = 34/61 (55%), Positives = 43/61 (70%), Gaps = 1/61 (1%)

Query: 541 EENVGNLLMVWRFFITFADVLGLWPFTLDEFVQAFHDHESR-LLGEIHLALLKSIIKDIE 599
            E  G+LLMVW F  TF +VLGL PFTLD+F +A    +S  LLGE+H+ALLK ++ D E
Sbjct: 1   GEAFGDLLMVWEFLNTFGEVLGLSPFTLDDFEEALLCTDSEELLGEVHIALLKLLVADEE 60

Query: 600 D 600
           D
Sbjct: 61  D 61


This domain is approximately 60 residues in length, and is predicted to be a DNA binding domain. The DDT domain is named after (DNA binding homeobox and Different Transcription factors). It is exclusively associated with nuclear domains, and is thought to be arranged into three alpha helices. Length = 61

>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|214726 smart00571, DDT, domain in different transcription and chromosome remodeling factors Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|204935 pfam12474, PKK, Polo kinase kinase Back     alignment and domain information
>gnl|CDD|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|129661 TIGR00570, cdk7, CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|221408 pfam12072, DUF3552, Domain of unknown function (DUF3552) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|223783 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523) Back     alignment and domain information
>gnl|CDD|224755 COG1842, PspA, Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523) Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|206034 pfam13863, DUF4200, Domain of unknown function (DUF4200) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|204935 pfam12474, PKK, Polo kinase kinase Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information
>gnl|CDD|224308 COG1390, NtpE, Archaeal/vacuolar-type H+-ATPase subunit E [Energy production and conversion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1497
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 100.0
KOG0850245 consensus Transcription factor DLX and related pro 99.61
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 99.59
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.52
KOG0488309 consensus Transcription factor BarH and related HO 99.51
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 99.48
KOG0489261 consensus Transcription factor zerknullt and relat 99.47
PF0279161 DDT: DDT domain; InterPro: IPR004022 This domain i 99.41
KOG0492246 consensus Transcription factor MSH, contains HOX d 99.37
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.36
KOG0843197 consensus Transcription factor EMX1 and related HO 99.36
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.33
smart0057163 DDT domain in different transcription and chromoso 99.31
KOG0848317 consensus Transcription factor Caudal, contains HO 99.3
KOG0494332 consensus Transcription factor CHX10 and related H 99.29
KOG0844408 consensus Transcription factor EVX1, contains HOX 99.28
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.26
KOG10291118 consensus Endocytic adaptor protein intersectin [S 99.25
KOG3802398 consensus Transcription factor OCT-1, contains POU 99.17
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.15
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.13
KOG0491194 consensus Transcription factor BSH, contains HOX d 99.12
KOG0493342 consensus Transcription factor Engrailed, contains 99.09
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.05
KOG1245 1404 consensus Chromatin remodeling complex WSTF-ISWI, 99.04
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.02
KOG0486351 consensus Transcription factor PTX1, contains HOX 99.01
PF1561338 WHIM2: WSTF, HB1, Itc1p, MBD9 motif 2 99.01
COG5576156 Homeodomain-containing transcription factor [Trans 99.0
KOG0483198 consensus Transcription factor HEX, contains HOX a 98.92
KOG0847288 consensus Transcription factor, contains HOX domai 98.9
PF1561446 WHIM3: WSTF, HB1, Itc1p, MBD9 motif 3 98.8
KOG0490235 consensus Transcription factor, contains HOX domai 98.69
KOG0849354 consensus Transcription factor PRD and related pro 98.58
KOG10291118 consensus Endocytic adaptor protein intersectin [S 98.5
PF1561250 WHIM1: WSTF, HB1, Itc1p, MBD9 motif 1; PDB: 2Y9Z_B 98.41
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 98.4
KOG0775304 consensus Transcription factor SIX and related HOX 98.27
PTZ001212084 MAEBL; Provisional 98.22
PTZ001212084 MAEBL; Provisional 98.17
KOG0774334 consensus Transcription factor PBX and related HOX 98.15
PTZ002661021 NIMA-related protein kinase; Provisional 98.07
KOG4364811 consensus Chromatin assembly factor-I [Chromatin s 97.72
PF0506672 HARE-HTH: HB1, ASXL, restriction endonuclease HTH 97.71
KOG4364811 consensus Chromatin assembly factor-I [Chromatin s 97.6
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.27
KOG2252558 consensus CCAAT displacement protein and related h 97.16
PF05672171 MAP7: MAP7 (E-MAP-115) family; InterPro: IPR008604 97.05
KOG2891445 consensus Surface glycoprotein [General function p 96.99
KOG0490235 consensus Transcription factor, contains HOX domai 96.97
KOG2891445 consensus Surface glycoprotein [General function p 96.88
KOG11461406 consensus Homeobox protein [General function predi 96.31
KOG11441064 consensus Translation initiation factor 5B (eIF-5B 96.28
KOG01631259 consensus Myosin class VI heavy chain [Cytoskeleto 95.39
PF05262489 Borrelia_P83: Borrelia P83/100 protein; InterPro: 95.39
PF05672171 MAP7: MAP7 (E-MAP-115) family; InterPro: IPR008604 95.29
KOG01631259 consensus Myosin class VI heavy chain [Cytoskeleto 95.24
PF05262489 Borrelia_P83: Borrelia P83/100 protein; InterPro: 94.34
KOG19241102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 93.73
KOG05791187 consensus Ste20-like serine/threonine protein kina 93.53
KOG2072988 consensus Translation initiation factor 3, subunit 93.47
COG3064387 TolA Membrane protein involved in colicin uptake [ 92.65
KOG2412591 consensus Nuclear-export-signal (NES)-containing p 91.87
KOG2412591 consensus Nuclear-export-signal (NES)-containing p 91.74
KOG3054299 consensus Uncharacterized conserved protein [Funct 91.34
KOG19241102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 91.13
COG3064387 TolA Membrane protein involved in colicin uptake [ 90.84
KOG3654708 consensus Uncharacterized CH domain protein [Cytos 89.72
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 89.52
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 89.17
KOG3054299 consensus Uncharacterized conserved protein [Funct 88.91
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 88.35
PRK00106535 hypothetical protein; Provisional 88.21
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 87.84
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 87.06
KOG0773342 consensus Transcription factor MEIS1 and related H 86.33
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 85.43
PRK12704520 phosphodiesterase; Provisional 85.11
PRK12704520 phosphodiesterase; Provisional 84.85
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
Probab=100.00  E-value=3.2e-34  Score=351.77  Aligned_cols=271  Identities=14%  Similarity=0.067  Sum_probs=204.1

Q ss_pred             hhhccccCCcccCCCceeeeccCCCCCCCCCCeeEEecCCC--cEEEEcCHHHHHHHHHhcccCCcchHHHHHHHHHHHH
Q 000448         1113 YVYRSLPLGQDRRRNRYWQFATSASRNDPCSGRIFVELHDG--TWRLIDTVEAFDALLSSLDARGTRESHLRIMLQKIET 1190 (1497)
Q Consensus      1113 ~v~R~~pLG~DR~~nRYW~f~~s~s~~d~g~~ri~VE~~~g--~W~~y~t~e~ld~Ll~~L~~rG~RE~~L~~~L~~~~~ 1190 (1497)
                      ..+|+.|||.||+++.||+.          .+||+||+.|+  .| ||+|.-+|-.||.+||.--+ |..|...|....+
T Consensus       408 ~~iR~~~iG~dr~gr~ywfi----------~rrl~Ie~~det~l~-yysT~pqly~ll~cLd~~~~-e~~L~d~i~~~~e  475 (1414)
T KOG1473|consen  408 DSIRHTPIGRDRYGRKYWFI----------SRRLRIEGMDETLLW-YYSTCPQLYHLLRCLDRTYV-EMYLCDGIWERRE  475 (1414)
T ss_pred             cceeccCCCcCccccchhce----------eeeeEEecCCCcEEE-EecCcHHHHHHHHHhchHHH-HHhhccchhhhHH
Confidence            34699999999999999998          78999999999  77 99999999999999996666 8899988888555


Q ss_pred             HHHHHHHHhhcCccccccccc---------cccccccc--------ccCCCCCCCCCCCCCCcccCCCCcccC--ccchh
Q 000448         1191 SFKDKVRRNLQGIDTVGQSWT---------AIKNEAAE--------MDVDPDFASSDSPSSTVCGLNSDTLET--SSSFR 1251 (1497)
Q Consensus      1191 ~i~~~m~~r~~~~~~~~~~~~---------~~~~~~~~--------~~~~~~~~~~~~p~s~~~~~~~~~~~~--~~~~~ 1251 (1497)
                          .+.++|..|...+++..         +.+.....        .++...-+.+  +-+.+..+. +...+  |.+..
T Consensus       476 ----e~~rqM~lT~~ltne~R~~~~f~~~~h~r~~l~~~c~~~lv~~iq~~~da~l--~e~~l~~i~-k~v~~~~S~s~~  548 (1414)
T KOG1473|consen  476 ----EIIRQMGLTEELTNELRGAVDFGEDPHGRLFLGRDCAVLLVLCIQVVEDAIL--KEENLGDID-KVVLVLISASAH  548 (1414)
T ss_pred             ----HHHHhccchhhhhhhhhcccccccCCCcceeeecchhhHHhhhhhhhhhhhh--hHhhhcchH-hhhhhhhhcccc
Confidence                55567777777777666         11111111        0000000000  000011111 01111  11111


Q ss_pred             hhcccchHHHHHHHHhhhhHHHHHHhhhccccchhhhccccchhccccccccccccccCccCCCCCcccccccCCCCCcc
Q 000448         1252 IELGRNEIEKKAALERFQDFQWWMWRECFNSLSLCASKNEKTRCRQLLVICDVCLDSYLCEDAHCPSCHRTFGAVDKSSK 1331 (1497)
Q Consensus      1252 ie~g~~~~e~~~~~~r~~~f~~w~w~~~~~~~~~~a~k~g~k~~~~~l~~c~~c~~~y~~~e~hc~~cH~tf~~~d~~~~ 1331 (1497)
                      -|   .-.|...+.++|++..  --+..+.+.  .+|.++++.|  .+.+++.......+.+..++.-|       +.++
T Consensus       549 ~e---E~~e~ck~is~~~d~p--~~n~~~~~e--~~~dqtf~~y--~ys~n~vse~~~~d~e~~dkk~~-------~~tk  612 (1414)
T KOG1473|consen  549 QE---EYVEICKAISQYWDLP--EGNLWRLRE--EGNDQTFMKY--YYSGNEVSEIFLTDSENADKKSH-------MQTK  612 (1414)
T ss_pred             hH---HHHHHHHHHhhccccc--ccchhhhhh--cccccchhhh--cccCCchhhccCCchhhhccccc-------ccce
Confidence            11   2345578888998887  555555656  7889999998  88999999999999999999999       7899


Q ss_pred             cchhhHHhhhhhccCCcccc--ccCCcchHHHHHHHhHHHHHHhcCChhhhhhhhhhhhhHHHHHhhcccCCHHHHHHHH
Q 000448         1332 FSEHSIQCEEKTKLGLRDIH--VSDSSLPLGIRLLKPLSAVIEAYIPPEALEASWTDERRKTWGMKLNMSSSAEEVLQLL 1409 (1497)
Q Consensus      1332 ~s~h~~~c~~k~~~~~~~~~--~~~~~~~~~~~~Lk~~l~~iE~~~p~~al~~~w~~~~rk~W~~~l~~~ss~~el~q~l 1409 (1497)
                      |++|++       +|..|.+  +++++-.....++...|...++.+|.+.++..|-.. -|.|...|..|-++.+|.-+|
T Consensus       613 f~l~~n-------sd~~~~g~~~t~gt~~~~~~~~~~t~~~~lSniP~s~~n~~w~~~-tkg~~lavs~A~~~~el~s~t  684 (1414)
T KOG1473|consen  613 FALITN-------SDGVTAGNVTTYGTGSQHKKLIARTLQQGLSNIPISYNNRKWPVY-TKGFELAVSAAADLAELSSET  684 (1414)
T ss_pred             eccccc-------ccceeccccccccchhhcchHHHhhhhhhhccCchHhhhccchhh-ccchhhhhhccchHHHHHHhh
Confidence            999988       8888866  888888999999999999999999999999999887 999999999999999999999


Q ss_pred             HHHHhhhhhhhcccccc
Q 000448         1410 TILESGIKRSYLSSNFE 1426 (1497)
Q Consensus      1410 ~~le~~ik~~~l~~~~~ 1426 (1497)
                      ..+.-+++-.-..+.|+
T Consensus       685 ~~~d~s~~~~~~~~~ss  701 (1414)
T KOG1473|consen  685 LEPDLSKRSNAFKAASS  701 (1414)
T ss_pred             cccchhhhhhhhccchh
Confidence            99999988877777665



>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>PF02791 DDT: DDT domain; InterPro: IPR004022 This domain is predicted to be a DNA binding domain Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>smart00571 DDT domain in different transcription and chromosome remodeling factors Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>PF15613 WHIM2: WSTF, HB1, Itc1p, MBD9 motif 2 Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>PF15614 WHIM3: WSTF, HB1, Itc1p, MBD9 motif 3 Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15612 WHIM1: WSTF, HB1, Itc1p, MBD9 motif 1; PDB: 2Y9Z_B 2Y9Y_B Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>PTZ00121 MAEBL; Provisional Back     alignment and domain information
>PTZ00121 MAEBL; Provisional Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics] Back     alignment and domain information
>PF05066 HARE-HTH: HB1, ASXL, restriction endonuclease HTH domain; InterPro: IPR007759 DNA-directed RNA polymerases 2 Back     alignment and domain information
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics] Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>PF05672 MAP7: MAP7 (E-MAP-115) family; InterPro: IPR008604 The organisation of microtubules varies with the cell type and is presumably controlled by tissue-specific microtubule-associated proteins (MAPs) Back     alignment and domain information
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins Back     alignment and domain information
>PF05672 MAP7: MAP7 (E-MAP-115) family; InterPro: IPR008604 The organisation of microtubules varies with the cell type and is presumably controlled by tissue-specific microtubule-associated proteins (MAPs) Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification] Back     alignment and domain information
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification] Back     alignment and domain information
>KOG3054 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3654 consensus Uncharacterized CH domain protein [Cytoskeleton] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG3054 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1497
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 4e-06
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 5e-06
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 7e-06
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure

Iteration: 1

Score = 51.2 bits (121), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 26/57 (45%), Positives = 38/57 (66%), Gaps = 6/57 (10%) Query: 34 PKRQMK------TPFQLETLEKAYASETYPSESTRAELSEKLGLSDRQLQMWFCHRR 84 PKR+ + T FQLE LEKA++ YP TR EL+ K+GL++ ++Q+WF +RR Sbjct: 2 PKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRR 58
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1497
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 2e-16
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 7e-15
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 2e-14
1e3o_C160 Octamer-binding transcription factor 1; transcript 3e-14
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 8e-14
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-13
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 1e-13
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 2e-13
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 5e-13
2xsd_C164 POU domain, class 3, transcription factor 1; trans 5e-13
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 7e-13
2zuo_A861 MVP, major vault protein; repeat domains, protein- 3e-12
2zuo_A861 MVP, major vault protein; repeat domains, protein- 6e-11
2zuo_A861 MVP, major vault protein; repeat domains, protein- 1e-10
2zuo_A861 MVP, major vault protein; repeat domains, protein- 1e-09
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 4e-12
3d1n_I151 POU domain, class 6, transcription factor 1; prote 2e-11
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 2e-11
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 2e-11
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 5e-11
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 6e-11
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 7e-11
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 8e-11
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 8e-11
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 2e-10
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-10
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 2e-10
3a01_A93 Homeodomain-containing protein; homeodomain, prote 3e-10
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 4e-10
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 7e-10
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 1e-09
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 1e-09
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 2e-09
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 3e-09
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 3e-09
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 3e-09
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 3e-09
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 4e-09
1uhs_A72 HOP, homeodomain only protein; structural genomics 5e-09
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 5e-09
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 5e-09
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 8e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 9e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-05
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 1e-08
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 1e-08
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 1e-08
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 1e-08
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 2e-08
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-08
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 2e-08
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 3e-08
3a02_A60 Homeobox protein aristaless; homeodomain, developm 3e-08
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 4e-08
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 4e-08
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 4e-08
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 5e-08
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 6e-08
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 6e-08
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 7e-08
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 7e-08
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 3e-07
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 5e-07
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-06
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-06
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 7e-06
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-04
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 4e-06
4f61_I240 Stathmin-like domain R4; alpha-tubulin, beta-tubul 8e-06
4f61_I240 Stathmin-like domain R4; alpha-tubulin, beta-tubul 2e-05
4f61_I240 Stathmin-like domain R4; alpha-tubulin, beta-tubul 4e-04
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 9e-06
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-05
3k66_A239 Beta-amyloid-like protein; X-RAY amyloid precursor 2e-05
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 3e-05
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 2e-04
2e19_A64 Transcription factor 8; homeobox domain, structura 4e-04
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 4e-04
3ryc_E143 Stathmin-4; alpha-tubulin, beta-tubulin, GTPase, m 6e-04
3iyk_A526 VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongu 6e-04
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
 Score = 74.4 bits (183), Expect = 2e-16
 Identities = 17/70 (24%), Positives = 32/70 (45%)

Query: 26 SNEGQQGKPKRQMKTPFQLETLEKAYASETYPSESTRAELSEKLGLSDRQLQMWFCHRRL 85
          S+        +  K+  QL  L+ ++    +P +S    L++  GLS R+++ WF  RR 
Sbjct: 2  SSGSSGASIYKNKKSHEQLSALKGSFCRNQFPGQSEVEHLTKVTGLSTREVRKWFSDRRY 61

Query: 86 KDKKEKENPP 95
            +  K +  
Sbjct: 62 HCRNLKGSRS 71


>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 418 Back     alignment and structure
>4f61_I Stathmin-like domain R4; alpha-tubulin, beta-tubulin, GTPase, microtubule, RB3, stath tubulin, cell cycle; HET: GTP GDP; 4.17A {Artificial gene} Length = 240 Back     alignment and structure
>4f61_I Stathmin-like domain R4; alpha-tubulin, beta-tubulin, GTPase, microtubule, RB3, stath tubulin, cell cycle; HET: GTP GDP; 4.17A {Artificial gene} Length = 240 Back     alignment and structure
>4f61_I Stathmin-like domain R4; alpha-tubulin, beta-tubulin, GTPase, microtubule, RB3, stath tubulin, cell cycle; HET: GTP GDP; 4.17A {Artificial gene} Length = 240 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>3k66_A Beta-amyloid-like protein; X-RAY amyloid precursor protein, heparin binding, alternative splicing, developmental protein, differentiation; 2.70A {Caenorhabditis elegans} PDB: 3k6b_A* Length = 239 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>3ryc_E Stathmin-4; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Rattus norvegicus} PDB: 3ryf_E* 3ryh_E* 3ryi_E* 1sa0_E* 1sa1_E* 1z2b_E* 3du7_E* 3e22_E* 3hkb_E* 3hkc_E* 3hkd_E* 3hke_E* 3n2g_E* 3n2k_E* Length = 143 Back     alignment and structure
>3iyk_A VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongue virus} Length = 526 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1497
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-15
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 1e-14
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 3e-14
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 8e-14
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 2e-13
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 3e-13
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 9e-13
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 4e-12
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 4e-12
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 5e-12
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 5e-12
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 6e-12
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 7e-12
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 1e-11
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 2e-11
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 2e-11
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 4e-11
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 4e-11
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 4e-11
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 6e-11
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 6e-11
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 7e-11
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 1e-10
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 1e-10
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 1e-10
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-10
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 3e-10
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 5e-10
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 5e-10
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 1e-09
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 9e-09
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 9e-09
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 5e-08
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 2e-07
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 4e-05
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 3e-08
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 1e-07
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 6e-05
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 4e-04
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 3e-07
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 6e-07
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 8e-07
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 6e-05
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 0.002
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 70.2 bits (172), Expect = 2e-15
 Identities = 24/77 (31%), Positives = 40/77 (51%)

Query: 20 NNNNNHSNEGQQGKPKRQMKTPFQLETLEKAYASETYPSESTRAELSEKLGLSDRQLQMW 79
          NN   +    +  + KR   T  Q   LEK +    Y +   R E++  L L++RQ+++W
Sbjct: 1  NNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIW 60

Query: 80 FCHRRLKDKKEKENPPK 96
          F +RR+K KK  ++  K
Sbjct: 61 FQNRRMKMKKINKDRAK 77


>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1497
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.46
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.43
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.42
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.42
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.42
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.39
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.38
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.36
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.36
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.36
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.35
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.35
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.35
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.31
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.3
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.3
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.29
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.29
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.27
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.25
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.23
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.16
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.15
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.13
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.11
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.04
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.0
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 98.86
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 98.82
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 98.75
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 98.74
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.46  E-value=3.9e-14  Score=115.59  Aligned_cols=63  Identities=33%  Similarity=0.504  Sum_probs=59.0

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHCCC
Q ss_conf             999999876898899999998842399999999999998299922210012200222111014
Q 000448           30 QQGKPKRQMKTPFQLETLEKAYASETYPSESTRAELSEKLGLSDRQLQMWFCHRRLKDKKEKE   92 (1497)
Q Consensus        30 ~k~kr~Rt~ft~~Ql~~Le~~F~~~~yPs~~~r~eLA~~LgLs~~qVqvWFQNRRaK~Kr~~~   92 (1497)
                      +..|++|++||..|+.+|+..|..++||+...+..||..+||+++||+|||||||+|+|+...
T Consensus        11 ~~~rr~Rt~ft~~Ql~~Le~~F~~~~yPs~~~r~~LA~~l~l~~~qV~iWFqNrR~k~kr~~~   73 (77)
T d1pufa_          11 RSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINK   73 (77)
T ss_dssp             CTTSCCCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             767989988899999999999987799999999999998098877801002546788998878



>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure