Citrus Sinensis ID: 000568


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------
MSIIGEAILKACIELLVDKLTSKGLQFFAHQEQIQADLVKWKRMLVKIKAVLDDAEEKQRTDQSVKMWLGDLHNLAFDVEDLLEEFQTEAFRRKLLLGEPAAAAHDHDQTSSSRRSTTTKFRKLIPTCCTTFTLDSIKFEYVMISKIKEINDRFQEIVTQKDLLDLKESSAGGSKKAMQRLPTTSLVNEAKVYGRETEKKEIVELLLRDDLRNDGGFSVIPIIGMGGLGKTTLAQLVYNDHRVQDHFDLKAWTCVSNDFDVIRLTKTILRCITKQTIDDSDLNLLQEELNKQLSRKKFLLVLDDVWNENYNDWVDMSRPLEAGAPGSKIIVTTRNQEVVAIMGTAPAYQLKRLSTDDCLSVFTQHSLDSRDFSSNKSLEEIGKKIVIKCNGLPLAAKTLGGLLRGKHGPSDWEDVLNSNIWDLPEDRCGILPALRVSYYYLSPPLKQCFAYCSLLPKDYEFEEEEIILLWIAEGFLDHEDRDEEKEELGHQFFQELCSRSFFEKSSNDTSKFVMHDLVNDLARWAAGEIYFIMEGTLEVNKQQRISRNLRHLSYIRGEYDGVKRFAGFYDIKYLRTFLSIMLSNNSRGYLACSILHQLLKLQQLRVFTVLNLSRTNIRNLPESITKLYNLHTLLLEDCDRLKTLCADIGNLIKLHHLKNSNTISLQEMPLRFGKLTCLQTLCNFVVGNDRGSRLRELKFLMHLRGTLDISNLENVKHVGDAKEAHLSGKKNLKVLLLRWARNSFDSRVPETETRVLDMLKPHQNLEEFCINGYRGTKFPIWLGDSSLSKLVTLKFQYCGMCTSLPSVGQLRSLKHLEVRGMSGVKRLSLEFYGNDSPIPFPCLETLHFEDMKEWEEWIPRGSSQEIEGFPKLRELHISRCSKLRGTLPERLPALEMFVIQSCEELVVSVMSLPALCKFKIDGCKKVVWRSTTKHLGLILHIGGCPNLQSLVAEEEQEQQQLCDLSCKLEYLGLSYCQGLVTLPQSLLNLSSLREIYIRSCSSLVSFPEVALPSKLRLITIWDCEALKSLPEAWMCETNSSLEILNIAGCSSLTYITGVQLPPSLKLLLIFDCDSIRTLTVEEGIQSSSSSRYTSSLLEHLVIGRCPSLTCLFSKNGLPATLESLEVGNLPQSLKFLDVWECPKLESIAERLNNNTSLEVIDIGNCENLKILPSGLHNLCQLQRISIWCCGNLVSFSEGGLPCAKLTRLEISECERLEALPRGLRNLTCLQHLTIGDVLSPERDPEDEDRLPTNLHSLNIDNMKSWKSFIEWGQGGGGLNRFSSLQQLRIRGRDQDVVSFPPEEDIGLGLGTTLPLPATLTYLVIADLPNLERLSSSIFYHQNLTKLKLCNCPKLKYFPEKGLPASLLRLEISGCPLIEERYIKDGGQYRHLLTYIPCIIINGRPVDLDLKQRRIEY
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccEEEEEEccccccHHHHHHHHHHcHHHHccccccEEEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccEEEEEEcccccccHHcHHHHHHHHcccccccEEEEEcccHHHHHHHcccccCCcccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHccccccccccccccHHHHcccccccccccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccEEEcHHHHHHHHHHHcccEEEEccccccccccccccccEEEEEEEcccccccccccccccccccEEEEccccccccccccccccccccccccEEEEEEccccccccccccccccccccccEEEccccccccccHHHccccccccEEEcccccccccccccccccccccccccEEEccccccccHHHccccccccEEEECccccccccccHHccccccccccccEEEEEccccccccccHHHHHHHHccccccccccEEEEccccccccccccccccccccEEEEEccccccccccccccccccEEEEccccccEECcccccccccccccccccEEEECcccccccccccccccccccccccHHHHHccccccccccccccccccEEEEccccccHHcccccccccEEEEccccccEEcccccccccEEECcccccccccHHHHHHHHHHHccccccccEEEECcccccccccccccccccccEEEEEccccccccccccccccccEEEEccccccccccHHHcccccccccEEEECcccccccccccccccccccEEEEccccccccccccccccccccccccccccEEEECcccccccccccccccccccccccccccccccEEEECcccccHHHHHHccccccccEEEEccccccccccccccccccccEEEEECccccccccccccccccccEEEECcccccccccccccccccccEEEECccccccccccccccccccccEEEECcccccccHHccccccccccccccccEEEECccccccccccccccccccccccccccccccEEEECcccccccccccccccccccEEEECccccccccccccccccccEEEECccHHHHHHHcccccccccccccccEEEEccCEEccccccccccc
MSIIGEAILKACIELLVDKLTSKGLQFFAHQEQIQADLVKWKRMLVKIKAVLDDAEEKQRTDQSVKMWLGDLHNLAFDVEDLLEEFQTEAFRRKLLLG*********************KFRKLIPTCCTTFTLDSIKFEYVMISKIKEINDRFQEIVTQKDLL***********************NEAKVYGRETEKKEIVELLLRDDLRNDGGFSVIPIIGMGGLGKTTLAQLVYNDHRVQDHFDLKAWTCVSNDFDVIRLTKTILRCITKQTIDDSDLNLLQEELNKQLSRKKFLLVLDDVWNENYNDWVDMSRPLEAGAPGSKIIVTTRNQEVVAIMGTAPAYQLKRLSTDDCLSVFTQHSLDSR******SLEEIGKKIVIKCNGLPLAAKTLGGLLRGKHGPSDWEDVLNSNIWDLPEDRCGILPALRVSYYYLSPPLKQCFAYCSLLPKDYEFEEEEIILLWIAEGFLDHEDRDEEKEELGHQFFQELCSRSFFEKSSNDTSKFVMHDLVNDLARWAAGEIYFIMEGTLEVNKQQRISRNLRHLSYIRGEYDGVKRFAGFYDIKYLRTFLSIMLSNNSRGYLACSILHQLLKLQQLRVFTVLNLSRTNIRNLPESITKLYNLHTLLLEDCDRLKTLCADIGNLIKLHHLKNSNTISLQEMPLRFGKLTCLQTLCNFVVGNDRGSRLRELKFLMHLRGTLDISNLENVKHVGDAKEAHLSGKKNLKVLLLRWARNSFDSRVPETETRVLDMLKPHQNLEEFCINGYRGTKFPIWLGDSSLSKLVTLKFQYCGMCTSLPSVGQLRSLKHLEVRGMSGVKRLSLEFYGNDSPIPFPCLETLHFEDMKEWEEWIPRGSSQEIEGFPKLRELHISRCSKLRGTLPERLPALEMFVIQSCEELVVSVMSLPALCKFKIDGCKKVVWRSTTKHLGLILHIGGCPNLQSLVAEEEQEQQQLCDLSCKLEYLGLSYCQGLVTLPQSLLNLSSLREIYIRSCSSLVSFPEVALPSKLRLITIWDCEALKSLPEAWMCETNSSLEILNIAGCSSLTYITGVQLPPSLKLLLIFDCDSIRTLTVE************SSLLEHLVIGRCPSLTCLFSKNGLPATLESLEVGNLPQSLKFLDVWECPKLESIAERLNNNTSLEVIDIGNCENLKILPSGLHNLCQLQRISIWCCGNLVSFSEGGLPCAKLTRLEISECERLEALPRGLRNLTCLQHLTIGDVLSPERDPEDEDRLPTNLHSLNIDNMKSWKSFIEWGQGGGGLNRFSSLQQLRIRGRDQDVVSFPPEEDIGLGLGTTLPLPATLTYLVIADLPNLERLSSSIFYHQNLTKLKLCNCPKLKYFPEKGLPASLLRLEISGCPLIEERYIKDGGQYRHLLTYIPCIIINGRPVDLDL*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIIGEAILKACIELLVDKLTSKGLQFFAHQEQIQADxxxxxxxxxxxxxxxxxxxxxQRTDQSVKMWLGDLHNLAFDVEDLLEEFQTEAFRRKLLLGEPAAAAHDHDQTSSSRRSTTTKFRKLIPTCCTTFTLDSIKFEYVMISKIKEINDRFQEIVTQKDLLDLKESSAGGSKKAMQRLPTTSLVNEAKVYGRETEKKEIVELLLRDDLRNDGGFSVIPIIGMGGLGKTTLAQLVYNDHRVQDHFDLKAWTCVSNDFDVIRLTKTILRCITKQTIDDSDLNLLQEELNKQLSRKKFLLVLDDVWNENYNDWVDMSRPLEAGAPGSKIIVTTRNQEVVAIMGTAPAYQLKRLSTDDCLSVFTQHSLDSRDFSSNKSLEEIGKKIVIKCNGLPLAAKTLGGLLRGKHGPSDWEDVLNSNIWDLPEDRCGILPALRVSYYYLSPPLKQCFAYCSLLPKDYEFEEEEIILLWIAEGFLDHEDRDEEKEELGHQFFQELCSRSFFEKSSNDTSKFVMHDLVNDLARWAAGEIYFIMEGTLEVNKQQRISRNLRHLSYIRGEYDGVKRFAGFYDIKYLRTFLSIMLSNNSRGYLACSILHQLLKLQQLRVFTVLNLSRTNIRNLPESITKLYNLHTLLLEDCDRLKTLCADIGNLIKLHHLKNSNTISLQEMPLRFGKLTCLQTLCNFVVGNDRGSRLRELKFLMHLRGTLDISNLENVKHVGDAKEAHLSGKKNLKVLLLRWARNSFDSRVPETETRVLDMLKPHQNLEEFCINGYRGTKFPIWLGDSSLSKLVTLKFQYCGMCTSLPSVGQLRSLKHLEVRGMSGVKRLSLEFYGNDSPIPFPCLETLHFEDMKEWEEWIPRGSSQEIEGFPKLRELHISRCSKLRGTLPERLPALEMFVIQSCEELVVSVMSLPALCKFKIDGCKKVVWRSTTKHLGLILHIGGCPNLQSLVAEEEQEQQQLCDLSCKLEYLGLSYCQGLVTLPQSLLNLSSLREIYIRSCSSLVSFPEVALPSKLRLITIWDCEALKSLPEAWMCETNSSLEILNIAGCSSLTYITGVQLPPSLKLLLIFDCDSIRTLTVEEGIQSSSSSRYTSSLLEHLVIGRCPSLTCLFSKNGLPATLESLEVGNLPQSLKFLDVWECPKLESIAERLNNNTSLEVIDIGNCENLKILPSGLHNLCQLQRISIWCCGNLVSFSEGGLPCAKLTRLEISECERLEALPRGLRNLTCLQHLTIGDVLSPERDPEDEDRLPTNLHSLNIDNMKSWKSFIEWGQGGGGLNRFSSLQQLRIRGRDQDVVSFPPEEDIGLGLGTTLPLPATLTYLVIADLPNLERLSSSIFYHQNLTKLKLCNCPKLKYFPEKGLPASLLRLEISGCPLIEERYIKDGGQYRHLLTYIPCIIINGRPVDLDLKQRRIEY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Z6T, chain A
Confidence level:confident
Coverage over the Query: 54-93,105-162,173-473,486-670
View the alignment between query and template
View the model in PyMOL
Template: 2A5Y, chain B
Confidence level:confident
Coverage over the Query: 44-97,120-472,483-540
View the alignment between query and template
View the model in PyMOL
Template: 4FCG, chain A
Confidence level:probable
Coverage over the Query: 875-1067,1095-1182,1207-1241
View the alignment between query and template
View the model in PyMOL
Template: 1JL5, chain A
Confidence level:probable
Coverage over the Query: 941-1190
View the alignment between query and template
View the model in PyMOL
Template: 4FCG, chain A
Confidence level:probable
Coverage over the Query: 875-1067,1095-1182,1207-1241
View the alignment between query and template
View the model in PyMOL
Template: 4ECO, chain A
Confidence level:probable
Coverage over the Query: 871-1261,1279-1284,1300-1306,1318-1377
View the alignment between query and template
View the model in PyMOL
Template: 3FXI, chain A
Confidence level:probable
Coverage over the Query: 608-1000,1016-1137,1151-1171
View the alignment between query and template
View the model in PyMOL
Template: 4ECN, chain A
Confidence level:probable
Coverage over the Query: 785-1261
View the alignment between query and template
View the model in PyMOL
Template: 3QFL, chain A
Confidence level:probable
Coverage over the Query: 13-124
View the alignment between query and template
View the model in PyMOL
Template: 3J0A, chain A
Confidence level:probable
Coverage over the Query: 565-1001,1018-1069
View the alignment between query and template
View the model in PyMOL