Citrus Sinensis ID: 000592

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400--
MWHVAMSVFIIHFLRRFCCSSSSLLHFAKVQFQISLLIIHRGYKMNPPCPPFECAHMWGPFLVSSLKDSSLHSSLRQPAFDLIQTIIVSDAAALVTSVLKSARPLRTETIISVEMNEDEDDLKFPFDPDVDEKDDNSSWNEFTAQSRITSQEFRVWMCIPMLWIDVLVDINPSVLPVSFSKVVFWARSHFSIVEPEISAEMALDVRAWLSSSATEISSTFGWKAPTGCDDGGAGKVSKNSMEVSTMCLPLIRAFKRLTAHFIVQIGQGELRKQWTWEPRMGESLILSLVDPNDNVRQFGKCILEQVSNTRGLASGLKFLSSSTSSLSAIFLGLKHALKLVQLDSVLLKFQSLHHFFFVLRKIFEEGHLPKCDLLKSSSGHSSITMFSSQGGFLRQPQFESFDANTGCSSNIDLKLWEKFHYTLSEITWPSVKRCLQEGKTFLDYSLCQMTCIRVLEILPVVFGKVCPLLAEHSGYSATTTQNVFDFKWLHDLMDWGKSQLKVVIVYWKRTITCLLNLLKDSCSGTSLLTVSSIENLISSDHLDVDGLVEKVSLLCVSLSKESSRNSGKTLMSMAHFPEDLSVERKSAALDIRPFPVKDVDVEILDSETIASKSKDNLIVVSDDEIEKEPSVDQGLLSDFKSRQCVVVSKTGAPISDKRASQTESLKNRVSILDSSKDLLDGSGPASPKQVLDESVGKSLNSLDSKVVDGKKKESNSKFNASDSLSFQNRVGLRNKPVESSSFKNVNQASSNVVAKPTNKLLKELVCDVENDPLESSFKSGKHQQTYLTKSGPFVPKRQVIQLKSPFENRCGLHRMETGVKRFGPPKLDDWYKPILEIDYFATVGLASSREDENRVHCKLKEVPVCFQSPEQFVSIFRPLVLEEFKAQLHSSFLEMSSWEDMYYGSLSVLSVERVDDFHLVRFVHDDNDSVTSKIFSENDLVLLTRVSPQKTPHDVHMVGKVERRERDNNRRSSILLIRFYLQNGSVRLNQARRNLLERSKWHATLIMSITPQLREFHALSSLKSIPLLPIILNPVNVSRGYNESRELDLGKLSQLQQILKTSFNESQLQAISVAIGLSSSWKKDCELSLIQGPPGTGKTRTIVAIVSALLATRTSPKSHLKQNYSSCINSRPKIGQSAAIARAWQDAALARQINEDSERDKKSSESSVRARVLICAQSNAAVDELVSRISKEGLYGSDGKTYKPYLVRVGNVKTVHPNSLPFFIDTLVDHRLAEERMHLTDPKNEFCTRSSTLRSNLEKLVDRIRFFEAKRANTKDGNSDPKNMLDDEVHKGDDVKLSDVELEAKLRKLYEQKKQIYRELGVAQVQEKKSYEETKALKHKLRKSILKEAEIVVTTLSGCGGDLYGVCSESVSGFKFGNPSENTLFDAVVIDEAAQVVLVHEL
cccHHHHHHHHHHHHHcccccccHHHHHccccEEEEEEEEcccccccccccccccccccccHHcccccccccccccccHHHHHHHHHHccHHHHHHHHHHcccccccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHcccccccEEEEHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccEEccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccEEccEEEEEEEEcccccccccccccccEEEEEEcccccccccEEEEEEEEEEcccccccccEEEEEEEEccccccHHHHHcccccccEEEEEEEccccHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEccccccccccccccHHHHHHHHHHHHHHcccccccHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccccccccEEEEEccccccccccc
ccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHcccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEccccccccccccHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccEEEcccccccccccHHHHHHccccEEcccccEEccccccccccccccccEEEEcHcHHHHHHHHHHHHHHHHHHHHHcccccccEccHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHcccHHHHHHHHHHHHHHHHHHccccHHccHHHHHHHHHHHHHHHcccHcccccccccccccHHEEEcccccccccccccccccccccccccEccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcHHHcccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHcccEEEEEccccccccccccHHHHHHHcccccccccEEEccccHccccccccHEEHcccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccccccccHHHcccccccccccccccccccccccccHHHHcHccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccHcccHHcccHHHHHHcccccHHHHHHHHHHccHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEcEEcccEEEEEEEEcccHHHHccccccccEEEEEcccccccccccEEEEEEEEEEEcccccEEEEEEEEEEccccccccHHHHHcccccEEEEEEEEcccHHHHHHHHHHHHccccHHHHHHccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHccccccccccEEEEEcccccccHHHHHHHHHHHHHccccccccccccccccccccccccccHcccccccHHHHcccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHcccccccccEEccEEEEEcccHHHcHHHHHccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccccHHHHHHHHHHcccccccccccccccEEEEEEEHHHHEEEHHcc
MWHVAMSVFIIHFLRRfccssssllhfAKVQFQISLLIIHrgykmnppcppfecahmwgpfLVSSLKdsslhsslrqpaFDLIQTIIVSDAAALVTSVLKSARPLRTETIISvemnededdlkfpfdpdvdekddnsswneftaqsritSQEFRVWMCIPMLWIDVLvdinpsvlpvsfSKVVFWARshfsivepeiSAEMALDVRAWLSSSATEisstfgwkaptgcddggagkvsknsmEVSTMCLPLIRAFKRLTAHFIVQIGQGelrkqwtweprmgeslilslvdpndnvRQFGKCILEQVSNTRGLASGLKFLSSSTSSLSAIFLGLKHALKLVQLDSVLLKFQSLHHFFFVLRKIfeeghlpkcdllksssghssitmfssqggflrqpqfesfdantgcssnidLKLWEKFHYTLSEITWPSVKRCLQEGKTFLDYSLCQMTCIRvleilpvvfgkvcpllaehsgysatttqNVFDFKWLHDLMDWGKSQLKVVIVYWKRTITCLLNLLkdscsgtsllTVSSIENlissdhldvdgLVEKVSLLCVSLSkessrnsgktlmsmahfpedlSVERksaaldirpfpvkdvdveildsetiaskskdnlivvsddeiekepsvdqgllsdfksrqcvvvsktgapisdkrasqtESLKNRVSILdsskdlldgsgpaspkqvldesvgkslnsldskvvdgkkkesnskfnasdslsfqnrvglrnkpvesssfknvnqassnvvakptNKLLKELVCDvendplessfksgkhqqtyltksgpfvpkrqviqlkspfenrcglhrmetgvkrfgppklddwykpileiDYFATvglassredenrvhcklkevpvcfqspeqfVSIFRPLVLEEFKAQLHSSFLEMSSWEDMYYGSLSvlsvervddfhlvrfvhddndsvtskifsendlvlltrvspqktphdvhmvgkverrerdnnrRSSILLIRFYLQNGSVRLNQARRNLLERSKWHATLIMSITPQLREFHalsslksipllpiilnpvnvsrgynesreldlGKLSQLQQILKTSFNESQLQAISVAIGLssswkkdcelsliqgppgtgktRTIVAIVSALLatrtspkshlkqnysscinsrpkigQSAAIARAWQDAALARQINedserdkksseSSVRARVLICAQSNAAVDELVSRIskeglygsdgktykpylvrvgnvktvhpnslpffIDTLVDHRLAEermhltdpknefctrsSTLRSNLEKLVDRIRFFEAkrantkdgnsdpknmlddevhkgddvklsDVELEAKLRKLYEQKKQIYRELGVAQVQEKKSYEETKALKHKLRKSILKEAEIVVTTLsgcggdlygvcsesvsgfkfgnpsentlfdaVVIDEAAQVVLVHEL
MWHVAMSVFIIHFLRRFCCSSSSLLHFAKVQFQISLLIIHRGYKMNPPCPPFECAHMWGPFLVSSLKDSSLHSSLRQPAFDLIQTIIVSDAAALVTSvlksarplrtetiisvemnededdlkfPFDPDVDekddnsswneftaqsritsqefRVWMCIPMLWIDVLVDINPSVLPVSFSKVVFWARSHFSIVEPEISAEMALDVRAWLSSSATEISSTFGWKAPTGCDDGGAGKVSKNSMEVSTMCLPLIRAFKRLTAHFIVQIGqgelrkqwtwEPRMGESLILSLVDPNDNVRQFGKCILEQVSNTRGLASGLKFLSSSTSSLSAIFLGLKHALKLVQLDSVLLKFQSLHHFFFVLRKIFEEGHLPKCDLLKSSSGHSSITMFSSQGGFLRQPQFESFDANTGCSSNIDLKLWEKFHYTLSEITWPSVKRCLQEGKTFLDYSLCQMTCIRVLEILPVVFGKVCPLLAEHSGYSATTTQNVFDFKWLHDLMDWGKSQLKVVIVYWKRTITCLLNLLKDSCSGTSLLTVSSIENLISSDHLDVDGLVEKVSLLCVSLskessrnsgktlMSMAHFPEDLSVERKSaaldirpfpvkdvdveildsetiaskskdnlivvsddeiekepsvdqgllsdfksrQCVVVsktgapisdkrasqteslkNRVSILDsskdlldgsgpaSPKQvldesvgkslnsldskvvdgkkkesnskfnasdslsfqnrVGLRNkpvesssfknvnqassnvvakptnKLLKELVCDVENDPLessfksgkhqqtyltksgpfvpkrQVIQLKspfenrcglhrmetgvkrfgppklddWYKPILEIDYFATVGLASSREDENRVHCKLKevpvcfqspeQFVSIFRPLVLEEFKAQLHSSFLEMSSWEDMYYGSLSVLSVERVDDFHLVRfvhddndsvtskifsendlvlltrvspqktphdvhmvgkverrerdnnrrsSILLIRfylqngsvrlNQARRNLLERSKWHATLIMSITPQLREFHALSSLKSIPLLPIILNPVNVSRGYNESRELDLGKLSQLQQILKTSFNESQLQAISVAIGLSSSWKKDCELSLIqgppgtgktrTIVAIVSALlatrtspkshlkqnySSCINSRPKIGQSAAIARAWQDAALARQinedserdkkssessvRARVLICaqsnaavdelvsriskeglygsdgktykPYLVRVGNVKTVHPNSLPFFIDTLVDHRLAEERmhltdpknefctrsstlrsnleKLVDRIRFFeakrantkdgnsdpknmlddevhkgddvklSDVELEAKLRKLYEQKKQIYRelgvaqvqekksYEETKALKHKLRKSILKEAEIVVTTLSGCGGDLYGVCSESVSGFKFGNPSENTLFDAVVIDEAAQVVLVHEL
MWHVAMSVFIIhflrrfccssssllhfAKVQFQISLLIIHRGYKMNPPCPPFECAHMWGPFlvsslkdsslhsslRQPAFDLIQTIIVSDAAALVTSVLKSARPLRTETIISVEMNEDEDDLKFPFDPDVDEKDDNSSWNEFTAQSRITSQEFRVWMCIPMLWIDVLVDINPSVLPVSFSKVVFWARSHFSIVEPEISAEMALDVRAWLSSSATEISSTFGWKAPTGCDDGGAGKVSKNSMEVSTMCLPLIRAFKRLTAHFIVQIGQGELRKQWTWEPRMGESLILSLVDPNDNVRQFGKCILEQVSNTRGLAsglkflssstsslsAIFLGLKHALKLVQLDSVLLKFQSLHHFFFVLRKIFEEGHLPKCDLLKSSSGHSSITMFSSQGGFLRQPQFESFDANTGCSSNIDLKLWEKFHYTLSEITWPSVKRCLQEGKTFLDYSLCQMTCIRVLEILPVVFGKVCPLLAEHSGYSATTTQNVFDFKWLHDLMDWGKSQLKVVIVYWKRTITCLLNLLKDSCSGTSLLTVSSIENLISSDHLDVDGLVEKVSLLCVSLSKESSRNSGKTLMSMAHFPEDLSVERKSAALDIRPFPVKDVDVEILDSETIASKSKDNLIVVSDDEIEKEPSVDQGLLSDFKSRQCVVVSKTGAPISDKRASQTESLKNRVSILDSSKDLLDGSGPASPKQVLDESVGKSLNSLDSKVVDGKKKESNSKFNASDSLSFQNRVGLRNKPVESSSFKNVNQASSNVVAKPTNKLLKELVCDVENDPLESSFKSGKHQQTYLTKSGPFVPKRQVIQLKSPFENRCGLHRMETGVKRFGPPKLDDWYKPILEIDYFATVGLASSREDENRVHCKLKEVPVCFQSPEQFVSIFRPLVLEEFKAQLHSSFLEMSSWEDMYYGSLSVLSVERVDDFHLVRFVHDDNDSVTSKIFSENDLVLLTRVSPQKTPHDVHMVGKVerrerdnnrrssILLIRFYLQNGSVRLNQARRNLLERSKWHATLIMSITPQLREFHAlsslksipllpiilnpVNVSRGYNESRELDLGKLSQLQQILKTSFNESQLQAISVAIGLSSSWKKDCELSLIQGPPGTGKTRTIVAIVSALLATRTSPKSHLKQNYSSCINSRPKIGQSAAIARAWQDAALARQINedserdkkssessVRARVLICAQSNAAVDELVSRISKEGLYGSDGKTYKPYLVRVGNVKTVHPNSLPFFIDTLVDHRLAEERMHLTDPKNEFCTRSSTLRSNLEKLVDRIRFFEAKRANTKDGNSDPKNMLDDEVHKGDDVKLSDVELEAKLRKLYEQKKQIYRELGVAQVQEKKSYEETKALKHKLRKSILKEAEIVVTTLSGCGGDLYGVCSESVSGFKFGNPSENTLFDAVVIDEAAQVVLVHEL
*WHVAMSVFIIHFLRRFCCSSSSLLHFAKVQFQISLLIIHRGYKMNPPCPPFECAHMWGPFLVSSLKDSSLHSSLRQPAFDLIQTIIVSDAAALVTSVLKSARPLRTETIIS********************************QSRITSQEFRVWMCIPMLWIDVLVDINPSVLPVSFSKVVFWARSHFSIVEPEISAEMALDVRAWLSSSATEISSTFGWKAPTGCDDG*********MEVSTMCLPLIRAFKRLTAHFIVQIGQGELRKQWTWEPRMGESLILSLVDPNDNVRQFGKCILEQVSNTR*****************AIFLGLKHALKLVQLDSVLLKFQSLHHFFFVLRKIFEEGHLPKCDLL****************GFLRQPQFESFDANTGCSSNIDLKLWEKFHYTLSEITWPSVKRCLQEGKTFLDYSLCQMTCIRVLEILPVVFGKVCPLLAEHSGYSATTTQNVFDFKWLHDLMDWGKSQLKVVIVYWKRTITCLLNLLKDSCSGTSLLTVSSIENLISSDHLDVDGLVEKVSLLCVSL******************************LDIRPFPVKDVDVEILDS**********LIV***********************QCVVV****************************************************************************************************************LLKELVCD*************************FVPKRQVIQLKSPFENRCGLHRMETGVKRFGPPKLDDWYKPILEIDYFATVGLASSREDENRVHCKLKEVPVCFQSPEQFVSIFRPLVLEEFKAQLHSSFLEMSSWEDMYYGSLSVLSVERVDDFHLVRFVHDDNDSVTSKIFSENDLVLLTRV**************************SILLIRFYLQNGSVRLNQARRNLLERSKWHATLIMSITPQLREFHALSSLKSIPLLPIILNPVNVSRGYNESRELDLGKLSQLQQILKTSFNESQLQAISVAIGLSSSWKKDCELSLIQGPPGTGKTRTIVAIVSALLATR************************AAIARAWQD***********************ARVLICAQSNAAVDELVSRISKEGLYGSDGKTYKPYLVRVGNVKTVHPNSLPFFIDTLVDHRLAEERMHLT*****FCT*******NLEKLVDRIRFF*************************************KLRKLYEQKKQIYRELGVAQV***********LKHKLRKSILKEAEIVVTTLSGCGGDLYGVCSESVSGFKFGNPSENTLFDAVVIDEAAQVVLV***
*W*VAMSVFIIHFLRRFCCSSSSLLHFAKVQFQISLLIIHRGYKMNPPCPPFECAHMWGPFLVSSLKDSSLHSSLRQPAFDLIQTIIVSDAAALVTSVLKSARPLRTETIISVEMNEDEDDLKFPFDPDVDEKDDNSSWNEFTAQSRITSQEFRVWMCIPMLWIDVLVDINPSVLPVSFSKVVFWARSHFSIVEPEISAEMALDVRAWLSSSATEISSTFGWKAPT***********KNSMEVSTMCLPLIRAFKRLTAHFIVQIGQGELRKQWTWEPRMGESLILSLVDPNDNVRQFGKCILEQVSNTRGLASGLKFLSSSTSSLSAIFLGLKHALKLVQLDSVLLKFQSLHHFFFVLRKIFEEGHLPKCDLLKSSSGHSSITMFSSQGGFLRQPQFESFDANTGCSSNIDLKLWEKFHYTLSEITWPSVKRCLQEGKTFLDYSLCQMTCIRVLEILPVVFGKVCPLLAEHSGYSATTTQNVFDFKWLHDLMDWGKSQLKVVIVYWKRTITCLLNLL****************NLISSDHLDVDGLVEKVSLL********************************************************************************************************************************************************************************************************************************************************************************LDDWYKPILEIDYFATVGL*************LKEVPVCFQSPEQFVSIFRPLVLEEFKAQLHSSF*****W**MYYGSLSVLSVERVDDFHLVRFVHDDNDSVTSKIFSENDLVLLTRVSPQKTPHDVHMVGKVERRERDNNRRSSILLIRFYLQNGSVRLNQARRNLLERSKWHATLIMSITPQLREFHALSSLKSIPLLPIILNPVNVSRGYNESRELDLGKLSQLQQILKTSFNESQLQAISVAIGL******DCELSLIQGPPGTGKTRTIVAIVSALLATRTSPKSHLKQNYSSCINSRPKIGQSAAIARAWQDAALARQINED**********SVRARVLICAQSNAAVDELVSRISKEGLYGSDGKTYKPYLVRVGNVKTVHPNSLPFFIDTLVDHRLA************FCTRSSTLRSNLEKLVDRIRFFEAKRANTKDGNSDP***************LSDVELEAKLRKLYEQK*******************ETKALKHKLRKSILKEAEIVVTTLSGCGGDLYGVCSESVSGFKFGNPSENTLFDAVVIDEAAQVVLVHEL
MWHVAMSVFIIHFLRRFCCSSSSLLHFAKVQFQISLLIIHRGYKMNPPCPPFECAHMWGPFLVSSLKDSSLHSSLRQPAFDLIQTIIVSDAAALVTSVLKSARPLRTETIISVEMNEDEDDLKFPFDPDVDEKDDNSSWNEFTAQSRITSQEFRVWMCIPMLWIDVLVDINPSVLPVSFSKVVFWARSHFSIVEPEISAEMALDVRAWLSSSATEISSTFGWKAPTGCDDGGAGKVSKNSMEVSTMCLPLIRAFKRLTAHFIVQIGQGELRKQWTWEPRMGESLILSLVDPNDNVRQFGKCILEQVSNTRGLASGLKFLSSSTSSLSAIFLGLKHALKLVQLDSVLLKFQSLHHFFFVLRKIFEEGHLPKCDLLKSSSGHSSITMFSSQGGFLRQPQFESFDANTGCSSNIDLKLWEKFHYTLSEITWPSVKRCLQEGKTFLDYSLCQMTCIRVLEILPVVFGKVCPLLAEHSGYSATTTQNVFDFKWLHDLMDWGKSQLKVVIVYWKRTITCLLNLLKDSCSGTSLLTVSSIENLISSDHLDVDGLVEKVSLLCVSL*********KTLMSMAHFPEDLSVERKSAALDIRPFPVKDVDVEILDSETIASKSKDNLIVVSDDEIEKEPSVDQGLLSDFKSRQCVVVSKTGAPISDKRASQTESLKNRVSILDSSKDLLDGSGPASPKQVLDESVGKSLNSLDSK**************ASDSLSFQNRVGLRNKPVESSSFKNVNQASSNVVAKPTNKLLKELVCDVENDPLESSFKSGKHQQTYLTKSGPFVPKRQVIQLKSPFENRCGLHRMETGVKRFGPPKLDDWYKPILEIDYFATVGLASSREDENRVHCKLKEVPVCFQSPEQFVSIFRPLVLEEFKAQLHSSFLEMSSWEDMYYGSLSVLSVERVDDFHLVRFVHDDNDSVTSKIFSENDLVLLTRVSPQKTPHDVHMVGKVERRERDNNRRSSILLIRFYLQNGSVRLNQARRNLLERSKWHATLIMSITPQLREFHALSSLKSIPLLPIILNPVNVSRGYNESRELDLGKLSQLQQILKTSFNESQLQAISVAIGLSSSWKKDCELSLIQGPPGTGKTRTIVAIVSALLATRTSPKSHLKQNYSSCINSRPKIGQSAAIARAWQDAALAR******************ARVLICAQSNAAVDELVSRISKEGLYGSDGKTYKPYLVRVGNVKTVHPNSLPFFIDTLVDHRLAEERMHLTDPKNEFCTRSSTLRSNLEKLVDRIRFFEAKRANTKDGNSDPKNMLDDEVHKGDDVKLSDVELEAKLRKLYEQKKQIYRELGVAQVQEKKSYEETKALKHKLRKSILKEAEIVVTTLSGCGGDLYGVCSESVSGFKFGNPSENTLFDAVVIDEAAQVVLVHEL
MWHVAMSVFIIHFLRRFCCSSSSLLHFAKVQFQISLLIIHRGYKMNPPCPPFECAHMWGPFLVSSLKDSSLHSSLRQPAFDLIQTIIVSDAAALVTSVLKSARPLRTETIISVEMNEDEDDLKFPFDPDVDEKDDNSSWNEFTAQSRITSQEFRVWMCIPMLWIDVLVDINPSVLPVSFSKVVFWARSHFSIVEPEISAEMALDVRAWLSSSATEISSTFGWKAPTGCDDGGAGKVSKNSMEVSTMCLPLIRAFKRLTAHFIVQIGQGELRKQWTWEPRMGESLILSLVDPNDNVRQFGKCILEQVSNTRGLASGLKFLSSSTSSLSAIFLGLKHALKLVQLDSVLLKFQSLHHFFFVLRKIFEEGHLPKCDLLKSSSGHSSITMFSSQGGFLRQPQFESFDANTGCSSNIDLKLWEKFHYTLSEITWPSVKRCLQEGKTFLDYSLCQMTCIRVLEILPVVFGKVCPLLAEHSGYSATTTQNVFDFKWLHDLMDWGKSQLKVVIVYWKRTITCLLNLLKDSCSGTSLLTVSSIENLISSDHLDVDGLVEKVSLLCVSLSKESSRNSGKTLMSMAHFPEDLSVERKSAALDIRPFPVKDVDVEILDSETIASKSKDNLIVVSDD************LSDF**********************************************************************************************************************************************************************************GVKRFGPPKLDDWYKPILEIDYFATVGLASSREDENRVHCKLKEVPVCFQSPEQFVSIFRPLVLEEFKAQLHSSFLEMSSWEDMYYGSLSVLSVERVDDFHLVRFVHDDNDSVTSKIFSENDLVLLTRVSPQKTPHDVHMVGKVERRERDNNRRSSILLIRFYLQNGSVRLNQARRNLLERSKWHATLIMSITPQLREFHALSSLKSIPLLPIILNPVNVSRGYNESRELDLGKLSQLQQILKTSFNESQLQAISVAIGLSSSWKKDCELSLIQGPPGTGKTRTIVAIVSALLATRT********************************A*L***************ESSVRARVLICAQSNAAVDELVSRISKEGLYGSDGKTYKPYLVRVGNVKTVHPNSLPFFIDTLVDHRLAEERMHLTDPKNEFCTRSSTLRSNLEKLVDRIRFFEAKRANTKDGNSDPKNMLDDEVHKGDDVKLSDVELEAKLRKLYEQKKQIYRELGVAQVQEKKSYEETKALKHKLRKSILKEAEIVVTTLSGCGGDLYGVCSESVSGFKFGNPSENTLFDAVVIDEAAQVVLVHEL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWHVAMSVFIIHFLRRFCCSSSSLLHFAKVQFQISLLIIHRGYKMNPPCPPFECAHMWGPFLVSSLKDSSLHSSLRQPAFDLIQTIIVSDAAALVTSVLKSARPLRTETIISVEMNEDEDDLKFPFDPDVDEKDDNSSWNEFTAQSRITSQEFRVWMCIPMLWIDVLVDINPSVLPVSFSKVVFWARSHFSIVEPEISAEMALDVRAWLSSSATEISSTFGWKAPTGCDDGGAGKVSKNSMEVSTMCLPLIRAFKRLTAHFIVQIGQGELRKQWTWEPRMGESLILSLVDPNDNVRQFGKCILEQVSNTRGLASGLKFLSSSTSSLSAIFLGLKHALKLVQLDSVLLKFQSLHHFFFVLRKIFEEGHLPKCDLLKSSSGHSSITMFSSQGGFLRQPQFESFDANTGCSSNIDLKLWEKFHYTLSEITWPSVKRCLQEGKTFLDYSLCQMTCIRVLEILPVVFGKVCPLLAEHSGYSATTTQNVFDFKWLHDLMDWGKSQLKVVIVYWKRTITCLLNLLKDSCSGTSLLTVSSIENLISSDHLDVDGLVEKVSLLCVSLSKESSRNSGKTLMSMAHFPEDLSVERKSAALDIRPFPVKDVDVEILDSETIASKSKDNLIVVSDDEIEKEPSVDQGLLSDFKSRQCVVVSKTGAPISDKRASQTESLKNRVSILDSSKDLLDGSGPASPKQVLDESVGKSLNSLDSKVVDGKKKESNSKFNASDSLSFQNRVGLRNKPVESSSFKNVNQASSNVVAKPTNKLLKELVCDVENDPLESSFKSGKHQQTYLTKSGPFVPKRQVIQLKSPFENRCGLHRMETGVKRFGPPKLDDWYKPILEIDYFATVGLASSREDENRVHCKLKEVPVCFQSPEQFVSIFRPLVLEEFKAQLHSSFLEMSSWEDMYYGSLSVLSVERVDDFHLVRFVHDDNDSVTSKIFSENDLVLLTRVSPQKTPHDVHMVGKVERRERDNNRRSSILLIRFYLQNGSVRLNQARRNLLERSKWHATLIMSITPQLREFHALSSLKSIPLLPIILNPVNVSRGYNESRELDLGKLSQLQQILKTSFNESQLQAISVAIGLSSSWKKDCELSLIQGPPGTGKTRTIVAIVSALLATRTSPKSHLKQNYSSCINSRPKIGQSAAIARAWQDAALARQINEDSERDKKSSESSVRARVLICAQSNAAVDELVSRISKEGLYGSDGKTYKPYLVRVGNVKTVHPNSLPFFIDTLVDHRLAEERMHLTDPKNEFCTRSSTLRSNLEKLVDRIRFFEAKRANTKDGNSDPKNMLDDEVHKGDDVKLSDVELEAKLRKLYEQKKQIYRELGVAQVQEKKSYEETKALKHKLRKSILKEAEIVVTTLSGCGGDLYGVCSESVSGFKFGNPSENTLFDAVVIDEAAQVVLVHEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1402 2.2.26 [Sep-21-2011]
O94387 1944 Uncharacterized ATP-depen yes no 0.318 0.229 0.247 3e-24
Q00416 2231 Helicase SEN1 OS=Saccharo yes no 0.325 0.204 0.254 3e-21
Q92355 1687 Helicase sen1 OS=Schizosa no no 0.345 0.286 0.245 1e-20
B6SFA4 818 Probable helicase MAGATAM no no 0.272 0.466 0.263 2e-20
A2AKX3 2646 Probable helicase senatax yes no 0.311 0.165 0.248 3e-18
Q86AS0 967 Probable helicase DDB_G02 no no 0.172 0.250 0.270 7e-18
Q7Z333 2677 Probable helicase senatax yes no 0.312 0.163 0.236 6e-15
>sp|O94387|YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1 Back     alignment and function desciption
 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 147/593 (24%), Positives = 257/593 (43%), Gaps = 147/593 (24%)

Query: 825  PKLDDWYKPILEIDYFATVGLASSREDENRVHCKLKEVPVCFQSPEQFVSIFRPLVLEEF 884
            P + ++YK IL  +  A    AS+      V  +  +    +     +  +F+P++  E 
Sbjct: 1057 PDVQEFYKVILGWNPLADSFSASN------VEMQCVQAKFTYNDSNAYEKVFKPMLFHEC 1110

Query: 885  KAQLHSSFLEMSSWEDMYYGSLSVLSVER--VDDFHLVRFVHDDNDSVTSKIFSENDLVL 942
             AQ+ S+       E+  Y  + ++   R  VD+F  + F       V+    S+ D+ L
Sbjct: 1111 WAQVKSAV------EEKQYPPIDLILNTRSTVDNFVDIYFTSCSPTEVS--FLSDTDICL 1162

Query: 943  LTRVSPQKTPHDVHMVGKVERRERDNNRRSSILLIRFYLQNGSVRLNQARRNLLERSKWH 1002
            L++       ++       + +     + S  L +R  ++  S+ L +   N+    ++ 
Sbjct: 1163 LSKSQSSGDTNNPKSFQLCKIQSISRKKESLELCLRMNIE--SIDLQEYAPNI----RFT 1216

Query: 1003 ATLIMSITPQLREFHALSSLKSIPLLPIILNPVNVSR---GYNESRELDLGKLSQLQQIL 1059
            A  + + T  LREF AL SL+ +PL   IL+  NV+R    + + ++         Q+I+
Sbjct: 1217 AQKLFNATTSLREFAALKSLRHLPLSQRILD-ANVTRLPSNFTDDKK---------QKIM 1266

Query: 1060 KT-SFNESQLQAI---SVAIGLSSSWKKDCELSLIQGPPGTGKTRTIVAIVSALLATRTS 1115
            K+   NE Q  AI   SV  G +          LIQGPPGTGKT+TI+ ++ A+L   TS
Sbjct: 1267 KSYGVNEPQAYAIYASSVNDGFT----------LIQGPPGTGKTKTILGMIGAVL---TS 1313

Query: 1116 PKSHLKQNYSSCINSRPKIGQSAAIARAWQDAALARQINEDSERDKKSSESSVRARVLIC 1175
                L+ N           GQ+                       +K+S++    ++LIC
Sbjct: 1314 SSQGLQFNVP---------GQT-----------------------RKTSKN----KILIC 1337

Query: 1176 AQSNAAVDELVSRISKEGLYGSDGKTYKPYLVRVGNVKTVHPNSLPFFIDTLVDHRLAEE 1235
            A SNAA+DE++ RI K G+Y  +G  + P ++RVG            F D++  H     
Sbjct: 1338 APSNAAIDEILLRI-KAGVYDHEGIKFFPKVIRVG------------FGDSISVH----- 1379

Query: 1236 RMHLTDPKNEFCTRSSTLRSNLEKLVDRIRFFEAKRANTKDGNSDPKNMLDDEVHKGDDV 1295
                         +  TL    E+++ ++     K+    + +SD +   D  + K D +
Sbjct: 1380 ------------AKEFTLE---EQMIKQMELTNLKKDQEANNSSDTRKKYDSIIKKRDSL 1424

Query: 1296 KLSDVE-----------LEAKLRKLYEQKKQIYRELGVAQVQEKKSYEETKALKHKLRKS 1344
            +  D+E           LEA+LR++ +QK  + + L   + +++ +      LK +++  
Sbjct: 1425 R-EDLEKFRSTGKNSSILEAQLREITKQKNMLEQSLDDMRERQRSTNRNLDVLKKQIQNQ 1483

Query: 1345 ILKEAEIVVTTLSGCGGDLYGVCSESVSGFKFGNPSENTLFDAVVIDEAAQVV 1397
            +L+EA+IV  TLS  G +L                +    F  V+IDEAAQ V
Sbjct: 1484 LLQEADIVCATLSASGHELL--------------LNAGLTFRTVIIDEAAQAV 1522

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|Q00416|SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2 Back     alignment and function description
>sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 Back     alignment and function description
>sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 Back     alignment and function description
>sp|A2AKX3|SETX_MOUSE Probable helicase senataxin OS=Mus musculus GN=Setx PE=2 SV=1 Back     alignment and function description
>sp|Q86AS0|Y4399_DICDI Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1 Back     alignment and function description
>sp|Q7Z333|SETX_HUMAN Probable helicase senataxin OS=Homo sapiens GN=SETX PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1402
297735762 2154 unnamed protein product [Vitis vinifera] 0.818 0.532 0.513 0.0
297850080 2129 hypothetical protein ARALYDRAFT_312653 [ 0.858 0.565 0.492 0.0
9954728 2142 Similar to tRNA-splicing endonuclease po 0.860 0.563 0.490 0.0
334182633 2127 hydrolase domain-containing protein [Ara 0.823 0.543 0.515 0.0
255544500 2110 splicing endonuclease positive effector 0.659 0.437 0.604 0.0
222641848 2215 hypothetical protein OsJ_29879 [Oryza sa 0.919 0.581 0.424 0.0
125564230 2181 hypothetical protein OsI_31894 [Oryza sa 0.880 0.566 0.412 0.0
357154159 2045 PREDICTED: uncharacterized protein LOC10 0.787 0.539 0.431 0.0
302811594 2281 hypothetical protein SELMODRAFT_426269 [ 0.351 0.216 0.372 6e-87
302796659 2265 hypothetical protein SELMODRAFT_444379 [ 0.351 0.217 0.368 3e-86
>gi|297735762|emb|CBI18449.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1222 bits (3162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 710/1383 (51%), Positives = 878/1383 (63%), Gaps = 235/1383 (16%)

Query: 33   QISLLIIHRGYKMNPPCPPFECAHMWGPFLVSSLKDSSLHSSLRQPAFDLIQTIIVSDAA 92
            QI+LLII RGYKMNPP PPFECAHMWGP LVSSLKDSSL +SLR+PAFDLI+T+IVSDAA
Sbjct: 479  QIALLIILRGYKMNPPSPPFECAHMWGPSLVSSLKDSSLENSLRRPAFDLIETLIVSDAA 538

Query: 93   ALVTSVLKSARPLRTETIISVEMNEDEDDLKFPFDPDVDEKDDNSSWNEFTAQSRITSQE 152
            ALVTS+L   +    +  + +E++++EDD + PF  DV+EK  +SSW+E++ QS+ITSQ+
Sbjct: 539  ALVTSMLNCCKHPSIDQSMIIELDDEEDDDELPFVLDVEEKH-SSSWSEYSEQSKITSQD 597

Query: 153  FRVWMCIPMLWIDVLVDINPSVLPVSFSKVVFWARSHFSIVEPEISAEMALDVRAWLSSS 212
             R W CIPMLW++VLV+INPSVLP+S SK VFWARS F++VEPE +AEM + V+ WLS S
Sbjct: 598  CRRWRCIPMLWLEVLVEINPSVLPISVSKAVFWARSRFALVEPEKNAEMEVPVKNWLSFS 657

Query: 213  ATEISSTFGWKAPTGCDDGGAGKVSKNSMEVSTMCLPLIRAFKRLTAHFIVQIGQGELRK 272
            A EISS+FGWK PTG DDGG GK S+NSM+VSTMC+PLIR FKRLTAH+IVQ+ Q ELRK
Sbjct: 658  AKEISSSFGWKVPTGSDDGGDGKESQNSMKVSTMCIPLIRTFKRLTAHYIVQMEQEELRK 717

Query: 273  QWTWEPRMGESLILSLVDPNDNVRQFGKCILEQVSNTRGLASGLKFLSSSTSSLSAIFLG 332
            QW WEPRMGESLIL L++PNDNVRQ GKC+LEQVSN RGLA  L+FL S T S+SA + G
Sbjct: 718  QWIWEPRMGESLILLLLEPNDNVRQVGKCLLEQVSNMRGLAHCLQFLCSCTLSMSATYNG 777

Query: 333  LKHALKLVQLDSVLLKFQSLHHFFFVLRKIFEEGHLPKCDLLKSSSGHSSITMFSSQGGF 392
            L+HAL+LVQ+DSVLL F++LHHFFFVL K+ +EG +   D  + SSG  +I+ FSSQGGF
Sbjct: 778  LRHALRLVQVDSVLLNFETLHHFFFVLCKLLKEGVICTSDPQRHSSGIKNISKFSSQGGF 837

Query: 393  LRQPQFESFDAN-TGCSSNIDLKLWEKFHYTLSEITWPSVKRCLQEGKTFLDYSLCQMTC 451
            LRQP F+SF  N  G SS  D K  EKF   LSEITWP +++CL EGK F+DY + Q+T 
Sbjct: 838  LRQPAFDSFPENVNGHSSVDDSKSREKFSCLLSEITWPFIRKCLVEGKAFVDYKISQLTL 897

Query: 452  IRVLEILPVVFGKVCPLLAEHSGYSATTTQNVFDF------------KWLHDLMDWGKSQ 499
              + E               H+  S  T  +V  F            +++   + WG   
Sbjct: 898  GYLFE--------------NHALLSKRTKASVRIFSLKDISYRLVLPRFIFYQIRWGLRL 943

Query: 500  LKVVIVYWKRTITCLLNLLKDSCSGTSLLTVSSIENLISSDHLDVDGLVEKVSLLCVSLS 559
                + YW++T+  LL+LLK SCS  S   + +IENLIS D L +D L E+V+ L VSLS
Sbjct: 944  SFCWVGYWRQTMISLLHLLKGSCSDKSASFIRAIENLISCDSLMMDELTEQVAHLSVSLS 1003

Query: 560  KESSRNSGKT-LMSMAHFPEDLSVERKSAALDIRPFPVKDVDVEILDSETIASKSKDN-L 617
             E+S   GKT L S A F ED S ER+ +A D++PF   D+DV+ILDS T+++K  +N +
Sbjct: 1004 NEASCIVGKTDLKSKAFFSEDSSFERQHSASDLQPFASDDMDVQILDSVTVSNKMDNNSV 1063

Query: 618  IVVSDDEIEKEPSVDQGLLSDFKSRQCVVVSKTGAPISDKRASQTESLKNRVSILDSSKD 677
            I++SDDE EK+ S ++  L  F+ R                                  D
Sbjct: 1064 IILSDDETEKQISSNKQFLEAFQQR----------------------------------D 1089

Query: 678  LLDGSGPASPKQVLDESVGKSLNSL--DSKVVDGKKKESNSKFNASDSLSFQNRVGLRNK 735
              D SG AS KQ LD +  + +++     K VD ++KE NSKF   DS   Q +  L + 
Sbjct: 1090 DSDTSGLASQKQELDTTKDRQISASHPKPKSVDSRRKEINSKFKVKDSFPSQFKGNLVST 1149

Query: 736  PVESSSFKNVNQASSNVVAKPTNKLLKELVCDVENDPLESSFKSGKHQQTYLTKSGPFVP 795
              ++++ K ++QA + V  K     +KE V D+ +DP E + KS K  Q+ LTK    +P
Sbjct: 1150 SDKTANLKIMDQALNRVALKTGETAIKESVRDIADDPWELAVKSLKPHQSCLTKPSASIP 1209

Query: 796  KRQVIQLKSPFENRCG-LHRMETGVKRFGPPKLDDWYKPILEIDYFATVGLASSREDENR 854
            KRQVIQL+ P ENR G L +++ GVKRF PPKLDDWY+PILEIDYF TVGLAS+ +DE++
Sbjct: 1210 KRQVIQLQLPGENRSGYLRKLDAGVKRFKPPKLDDWYRPILEIDYFVTVGLASASKDESQ 1269

Query: 855  VHCKLKEVPVCFQSPEQFVSIFRPLVLEEFKAQLHSSFLEMSSWEDMYYGSLSVLSVERV 914
               KLKEVP+CF+SP+Q+V IFRPLVLEEFKAQLHSSFLEMSS E M  GS SVLSVER+
Sbjct: 1270 TVNKLKEVPMCFESPDQYVDIFRPLVLEEFKAQLHSSFLEMSSSEGMCCGSASVLSVERI 1329

Query: 915  DDFHLVRFVHDDNDSVTSKIFSENDLVLLTRVSPQKTPHDVHMVGKVERRERDNNRRSSI 974
            DDFHLVR VHD +DS   + FSENDLVLLTR   Q + H+VHMVGKVERRE+D+  RS++
Sbjct: 1330 DDFHLVRCVHDGSDSAAYRTFSENDLVLLTRQPLQNSSHEVHMVGKVERREKDSKSRSNV 1389

Query: 975  LLIRFYLQNGSVRLNQARRNLLERSKWHATLIMSITPQLREFHALSSLKSIPLLPIILNP 1034
            L+IRFYLQNGS RLN+AR+ L+ERSKW+ +                              
Sbjct: 1390 LVIRFYLQNGSSRLNRARKLLIERSKWYLS------------------------------ 1419

Query: 1035 VNVSRGYNESRELDLGKLSQLQQILKTSFNESQLQAISVAIGLSSSWKKDCELSLIQGPP 1094
                                 ++IL++S+N SQLQAISVAI    S KK+ +LSLIQGPP
Sbjct: 1420 ---------------------RRILESSYNSSQLQAISVAIASPDS-KKNFDLSLIQGPP 1457

Query: 1095 GTGKTRTIVAIVSALLATRTSPKSHLKQNYSSCINSRPKIGQSAAIARAWQDAALARQIN 1154
            GTGKTRTIVAIVS LLA      S LK      +N +  +                    
Sbjct: 1458 GTGKTRTIVAIVSGLLA------SPLKG-----VNMKNSV-------------------- 1486

Query: 1155 EDSERDKKSSESSVRARVLICAQSNAAVDELVSRISKEGLYGSDGKTYKPYLVRVGNVKT 1214
             D ++  K   +SVR RVLICAQSNAAVDELVSRIS EGLY SDG  YKPYLVRVGNVKT
Sbjct: 1487 -DGKQSLKPMGTSVRQRVLICAQSNAAVDELVSRISSEGLYSSDGNMYKPYLVRVGNVKT 1545

Query: 1215 VHPNSLPFFIDTLVDHRLAEERMHLTDPKNEFCTRSSTLRSNLEKLVDRIRFFEAKRANT 1274
            VH NSLPFFIDTLVD RL                           LV+RIR +EAKRAN 
Sbjct: 1546 VHQNSLPFFIDTLVDQRL---------------------------LVERIRLYEAKRANL 1578

Query: 1275 KDGNSDPKNMLDDEVHKGDDVKLSDVELEAKLRKLYEQKKQIYRELGVAQVQEKKSYEET 1334
            +                         E+E KLR+LYEQKK+I                  
Sbjct: 1579 R-------------------------EIEVKLRRLYEQKKEI------------------ 1595

Query: 1335 KALKHKLRKSILKEAEIVVTTLSGCGGDLYGVCSESVSGFKFGNPSENTLFDAVVIDEAA 1394
                          +EIVV TLSGCGGDLYGVCSES+S  KFG  SEN LFDAVVIDEAA
Sbjct: 1596 --------------SEIVVATLSGCGGDLYGVCSESISTHKFGRSSENHLFDAVVIDEAA 1641

Query: 1395 QVV 1397
            Q +
Sbjct: 1642 QAL 1644

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297850080|ref|XP_002892921.1| hypothetical protein ARALYDRAFT_312653 [Arabidopsis lyrata subsp. lyrata] gi|297338763|gb|EFH69180.1| hypothetical protein ARALYDRAFT_312653 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|9954728|gb|AAG09081.1|AC026237_2 Similar to tRNA-splicing endonuclease positive effector SEN1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334182633|ref|NP_173124.2| hydrolase domain-containing protein [Arabidopsis thaliana] gi|332191377|gb|AEE29498.1| hydrolase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255544500|ref|XP_002513311.1| splicing endonuclease positive effector sen1, putative [Ricinus communis] gi|223547219|gb|EEF48714.1| splicing endonuclease positive effector sen1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|222641848|gb|EEE69980.1| hypothetical protein OsJ_29879 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|125564230|gb|EAZ09610.1| hypothetical protein OsI_31894 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|357154159|ref|XP_003576691.1| PREDICTED: uncharacterized protein LOC100835663 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|302811594|ref|XP_002987486.1| hypothetical protein SELMODRAFT_426269 [Selaginella moellendorffii] gi|300144892|gb|EFJ11573.1| hypothetical protein SELMODRAFT_426269 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|302796659|ref|XP_002980091.1| hypothetical protein SELMODRAFT_444379 [Selaginella moellendorffii] gi|300152318|gb|EFJ18961.1| hypothetical protein SELMODRAFT_444379 [Selaginella moellendorffii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1402
TAIR|locus:2126480 1311 AT4G30100 [Arabidopsis thalian 0.346 0.370 0.260 1.1e-21
TAIR|locus:2059088 1090 AT2G19120 "AT2G19120" [Arabido 0.353 0.454 0.25 1.1e-19
DICTYBASE|DDB_G0274399 967 DDB_G0274399 "DNA2/NAM7 helica 0.029 0.043 0.571 3.7e-19
DICTYBASE|DDB_G0285243 2069 DDB_G0285243 "putative splicin 0.191 0.129 0.25 1.1e-15
TAIR|locus:2130384 818 MAA3 "MAGATAMA 3" [Arabidopsis 0.049 0.084 0.394 2.1e-14
SGD|S000004422 2231 SEN1 "Presumed helicase and su 0.063 0.039 0.385 1.6e-12
UNIPROTKB|G4NIZ8 2037 MGG_02784 "DNA-binding protein 0.126 0.087 0.25 3.2e-10
POMBASE|SPBC29A10.10c 1944 SPBC29A10.10c "tRNA-splicing e 0.104 0.075 0.286 6.5e-10
MGI|MGI:2443480 2646 Setx "senataxin" [Mus musculus 0.057 0.030 0.356 9.4e-10
DICTYBASE|DDB_G0268662 2523 DDB_G0268662 "DNA2/NAM7 helica 0.171 0.095 0.239 1.5e-09
TAIR|locus:2126480 AT4G30100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 286 (105.7 bits), Expect = 1.1e-21, Sum P(3) = 1.1e-21
 Identities = 139/534 (26%), Positives = 223/534 (41%)

Query:   859 LKEVPVCFQSPEQFVSIFRPLVLEEFKAQLHSSFLEMSSWEDMYYGSLSVLSVERVDDFH 918
             L+ VP  F+S +++V +F PL+ EE +AQL+S++ E++  E   Y  + +  +ER +   
Sbjct:   418 LQSVPERFESMDEYVRVFEPLLFEECRAQLYSTWEELA--EANSYMKVRIKFIERRERGW 475

Query:   919 LVRFVHDDNDSVTSKIFSENDLVLLTRVSPQKTPHDV--HMVGKVXXXXXXXXXXXXILL 976
                 ++  N+   +     +  VL   V   +  HD    + G V              +
Sbjct:   476 YDVILNSVNECKWA-FKEGDVAVLSNPVPESEGEHDDVGRVAGTVRRYIPVDTRDPHGAI 534

Query:   977 IRFYL----QNGS-VRLNQARRNLLERSKWHATLIMSITPQLREF---HAXXXXXXXXXX 1028
             + FY+     +GS +  N   R L  +  WH T++ SI    RE+   HA          
Sbjct:   535 LHFYVGDAYDSGSKIDDNHILRKLKPKEIWHLTVLGSIATTQREYVALHAFSQLNPQMQN 594

Query:  1029 XXXXXXVNVSRGYNESRELDLGKLS-QLQQILKTSFNESQLQAIS-----VAIGLSSSWK 1082
                         Y E         +      L  SFN  QL AI       A G SS  K
Sbjct:   595 AILKPSPEQFPNYGEQTPTVPDCFTPSFAGHLHRSFNAPQLAAIHWAAMHTAAGTSSGVK 654

Query:  1083 KD--CELSLIQGPPGTGKTRTIVAIVSALLATRTSPKSHLKQNYSSCIN-----SRPKIG 1135
             +      +L+QGPPGTGKT T+  +++ +   +       +Q Y+S +      S  ++ 
Sbjct:   655 RQDPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQ------YQQYYTSLLKKLAPESYKQVN 708

Query:  1136 QSAA--IARAWQDAALARQINXXXXXXXXXXXXXVRARVLICAQSNAAVDELVSRISKEG 1193
             +S++  I     D  L    N              + R+L+CA SNAA DEL+SR+   G
Sbjct:   709 ESSSDNIVSGSIDEVLQ---NMDQNLFRTLPKLCAKPRMLVCAPSNAATDELLSRVLDRG 765

Query:  1194 LYGSDGKTYKPYLVRVGNVKTVHPNSLPFFIDTLVDHRLAEERMHLTDPKNEFCTRSSTL 1253
                 + + Y+P + RVG V T    +    ++   D  LA+ R  +    +    R + L
Sbjct:   766 FIDGEMRVYRPDVARVG-VDTQTKAAQAVSVERRSDLLLAKSREEILGHIHNLRVRDAQL 824

Query:  1254 RSNLEKLVDRIRFFEAKRANTKDGNS--DPKN-MLDDEVHKGDDVKLSDVELEAKLRKLY 1310
               ++  L   +    A  AN   G+   DP   M+ D+       +LS V +EA+ + L 
Sbjct:   825 SQDIAGLKRELT--AAAFANRSQGSVGVDPDVLMVRDQTRDAMLQRLSAV-VEARDKDLV 881

Query:  1311 EQKKQIYRELGVAQVQEKKSYEETKALKHKLRKSILKEAEIVVTTLSGCGGDLY 1364
             E  + +  E G  +     + EE +A    L  S   EAEIV TT+S  G  L+
Sbjct:   882 EMSRLLIVE-GKFRAGTSFNLEEARA---SLEASFANEAEIVFTTVSSSGRKLF 931
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009506 "plasmodesma" evidence=IDA
TAIR|locus:2059088 AT2G19120 "AT2G19120" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0274399 DDB_G0274399 "DNA2/NAM7 helicase family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285243 DDB_G0285243 "putative splicing endonuclease" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2130384 MAA3 "MAGATAMA 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
SGD|S000004422 SEN1 "Presumed helicase and subunit of the Nrd1 complex (Nrd1p-Nab3p-Sen1p)" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|G4NIZ8 MGG_02784 "DNA-binding protein SMUBP-2" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
POMBASE|SPBC29A10.10c SPBC29A10.10c "tRNA-splicing endonuclease positive effector (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
MGI|MGI:2443480 Setx "senataxin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0268662 DDB_G0268662 "DNA2/NAM7 helicase family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1402
pfam13086220 pfam13086, AAA_11, AAA domain 2e-25
pfam1324573 pfam13245, AAA_19, Part of AAA domain 1e-06
TIGR00376 637 TIGR00376, TIGR00376, DNA helicase, putative 7e-06
TIGR01447 586 TIGR01447, recD, exodeoxyribonuclease V, alpha sub 9e-06
COG1112 767 COG1112, COG1112, Superfamily I DNA and RNA helica 1e-04
>gnl|CDD|221912 pfam13086, AAA_11, AAA domain Back     alignment and domain information 
 Score =  105 bits (265), Expect = 2e-25
 Identities = 74/336 (22%), Positives = 124/336 (36%), Gaps = 149/336 (44%)

Query: 1063 FNESQLQAISVAIGLSSSWKKDCELSLIQGPPGTGKTRTIVAIVSALLATRTSPKSHLKQ 1122
             N+SQ +AI  A  LSSS     +++LIQGPPGTGKT T   IV  +    ++       
Sbjct: 2    LNDSQREAIKKA--LSSS-----DITLIQGPPGTGKTTT---IVEIIKQLLSNAPGK--- 48

Query: 1123 NYSSCINSRPKIGQSAAIARAWQDAALARQINEDSERDKKSSESSVRARVLICAQSNAAV 1182
                                                            +VL+CA SN+AV
Sbjct: 49   ------------------------------------------------KVLVCAPSNSAV 60

Query: 1183 DELVSRISKEGLYGSDGKTYKPYLVRVGNV-KTVHPNSLPFFIDTLVDHRLAEERMHLTD 1241
            D ++ R+ ++         +   +VR+G+  + +H + L + ++ L++ +  +       
Sbjct: 61   DNILERLLEQK--------FGLKIVRIGSPAREIHEDVLQYSLEYLLEAKFEQLL----- 107

Query: 1242 PKNEFCTRSSTLRSNLEKLVDRIRFFEAKRANTKDGNSDPKNMLDDEVHKGDDVKLSDVE 1301
                             K + +++    +++                             
Sbjct: 108  -----------------KRIRKLKSLLEEKSK---------------------------- 122

Query: 1302 LEAKLRKLYEQKKQIYRELGVAQVQEKKSYEETKALKHKLRKSILKEAEIVVTTLSGCGG 1361
            L+ + RKL  + K++ +EL              + L+  +RK IL EA++V TTLSG G 
Sbjct: 123  LKRERRKLRSEIKKLKKEL--------------ERLRKSIRKEILDEADVVCTTLSGAG- 167

Query: 1362 DLYGVCSESVSGFKFGNPSENTLFDAVVIDEAAQVV 1397
                  S  + G K         FD V+IDEAAQ  
Sbjct: 168  ------SSLLEGLKK--------FDVVIIDEAAQAT 189

This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. Length = 220
>gnl|CDD|222005 pfam13245, AAA_19, Part of AAA domain Back     alignment and domain information
>gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative Back     alignment and domain information
>gnl|CDD|233417 TIGR01447, recD, exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>gnl|CDD|224037 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1402
KOG1802 935 consensus RNA helicase nonsense mRNA reducing fact 100.0
KOG1803 649 consensus DNA helicase [Replication, recombination 100.0
TIGR00376 637 DNA helicase, putative. The gene product may repre 99.98
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 99.96
KOG1805 1100 consensus DNA replication helicase [Replication, r 99.81
KOG1807 1025 consensus Helicases [Replication, recombination an 99.68
KOG1801 827 consensus tRNA-splicing endonuclease positive effe 99.31
PF1324576 AAA_19: Part of AAA domain 99.17
COG1112 767 Superfamily I DNA and RNA helicases and helicase s 99.16
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.91
PRK10875 615 recD exonuclease V subunit alpha; Provisional 98.48
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 98.44
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 98.38
KOG1806 1320 consensus DEAD box containing helicases [Replicati 98.37
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 98.23
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 98.1
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 97.99
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 97.97
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 97.94
KOG1804 775 consensus RNA helicase [RNA processing and modific 97.91
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 97.9
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.89
PRK11054 684 helD DNA helicase IV; Provisional 97.89
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 97.88
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 97.81
smart00487201 DEXDc DEAD-like helicases superfamily. 97.77
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.77
PRK13826 1102 Dtr system oriT relaxase; Provisional 97.69
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 97.69
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 97.64
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 97.58
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.43
PF04851184 ResIII: Type III restriction enzyme, res subunit; 97.22
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 96.91
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 96.68
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 96.62
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.5
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 96.5
PRK06851367 hypothetical protein; Provisional 96.41
smart00382148 AAA ATPases associated with a variety of cellular 96.24
PF00004132 AAA: ATPase family associated with various cellula 96.01
PRK07952244 DNA replication protein DnaC; Validated 95.91
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 95.87
PTZ00424401 helicase 45; Provisional 95.84
TIGR02928365 orc1/cdc6 family replication initiation protein. M 95.75
PHA02558 501 uvsW UvsW helicase; Provisional 95.75
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 95.74
PLN03025319 replication factor C subunit; Provisional 95.68
TIGR00609 1087 recB exodeoxyribonuclease V, beta subunit. All pro 95.53
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.52
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.51
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 95.47
PRK12377248 putative replication protein; Provisional 95.43
PRK05580 679 primosome assembly protein PriA; Validated 95.41
PRK10536262 hypothetical protein; Provisional 95.24
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.15
TIGR00643630 recG ATP-dependent DNA helicase RecG. 95.12
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 95.1
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 94.98
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 94.92
PRK12402337 replication factor C small subunit 2; Reviewed 94.89
PRK10876 1181 recB exonuclease V subunit beta; Provisional 94.76
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 94.76
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 94.74
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 94.73
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 94.67
PRK08181269 transposase; Validated 94.57
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 94.55
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 94.52
TIGR02533486 type_II_gspE general secretory pathway protein E. 94.47
PRK14974336 cell division protein FtsY; Provisional 94.46
PRK06893229 DNA replication initiation factor; Validated 94.45
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.44
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.33
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 94.31
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.27
PRK08084235 DNA replication initiation factor; Provisional 94.25
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 94.12
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 93.99
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 93.96
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 93.95
PRK00254 720 ski2-like helicase; Provisional 93.94
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 93.86
PRK10436462 hypothetical protein; Provisional 93.83
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 93.8
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 93.75
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 93.74
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 93.72
PF05729166 NACHT: NACHT domain 93.72
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 93.71
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 93.68
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 93.65
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 93.58
PRK08903227 DnaA regulatory inactivator Hda; Validated 93.55
PRK06526254 transposase; Provisional 93.55
PRK04296190 thymidine kinase; Provisional 93.54
PRK00440319 rfc replication factor C small subunit; Reviewed 93.54
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 93.51
PRK01172 674 ski2-like helicase; Provisional 93.41
CHL00181287 cbbX CbbX; Provisional 93.4
PHA02544316 44 clamp loader, small subunit; Provisional 93.36
PRK08116268 hypothetical protein; Validated 93.3
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 93.28
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 93.26
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 93.25
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 93.07
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 93.06
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 93.02
PRK04195 482 replication factor C large subunit; Provisional 92.98
PRK13833323 conjugal transfer protein TrbB; Provisional 92.96
PRK09183259 transposase/IS protein; Provisional 92.96
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 92.89
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 92.84
COG1484254 DnaC DNA replication protein [DNA replication, rec 92.83
COG3973 747 Superfamily I DNA and RNA helicases [General funct 92.81
PRK09401 1176 reverse gyrase; Reviewed 92.8
PRK10416318 signal recognition particle-docking protein FtsY; 92.8
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 92.79
PRK08533230 flagellar accessory protein FlaH; Reviewed 92.79
PRK13767 876 ATP-dependent helicase; Provisional 92.78
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 92.73
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 92.73
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 92.69
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 92.63
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 92.59
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 92.56
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 92.52
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 92.51
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 92.48
PRK06851367 hypothetical protein; Provisional 92.45
PRK11331459 5-methylcytosine-specific restriction enzyme subun 92.39
PHA00729226 NTP-binding motif containing protein 92.39
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 92.38
TIGR00064272 ftsY signal recognition particle-docking protein F 92.37
PRK06067234 flagellar accessory protein FlaH; Validated 92.36
PRK13894319 conjugal transfer ATPase TrbB; Provisional 92.33
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 92.33
PTZ001121164 origin recognition complex 1 protein; Provisional 92.33
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 92.32
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 92.26
PRK06921266 hypothetical protein; Provisional 92.25
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 92.21
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 92.21
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 92.2
smart00488289 DEXDc2 DEAD-like helicases superfamily. 92.16
smart00489289 DEXDc3 DEAD-like helicases superfamily. 92.16
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 92.15
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 92.15
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 92.05
PRK00771437 signal recognition particle protein Srp54; Provisi 91.99
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 91.97
cd03115173 SRP The signal recognition particle (SRP) mediates 91.96
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 91.93
PRK05973237 replicative DNA helicase; Provisional 91.9
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 91.78
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 91.71
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 91.63
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 91.6
PRK06835329 DNA replication protein DnaC; Validated 91.51
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 91.5
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 91.4
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 91.31
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 91.3
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 91.29
PRK03992389 proteasome-activating nucleotidase; Provisional 91.29
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 91.28
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 91.25
PF1355562 AAA_29: P-loop containing region of AAA domain 91.2
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 91.18
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 91.18
PRK06620214 hypothetical protein; Validated 91.14
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 91.03
TIGR00362405 DnaA chromosomal replication initiator protein Dna 90.99
PRK09361225 radB DNA repair and recombination protein RadB; Pr 90.93
PRK08727233 hypothetical protein; Validated 90.9
PRK10689 1147 transcription-repair coupling factor; Provisional 90.88
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 90.84
TIGR00595 505 priA primosomal protein N'. All proteins in this f 90.83
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 90.82
PRK02362 737 ski2-like helicase; Provisional 90.81
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 90.79
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 90.75
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 90.65
COG0470325 HolB ATPase involved in DNA replication [DNA repli 90.63
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 90.62
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 90.57
PTZ00110 545 helicase; Provisional 90.51
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 90.47
PRK14701 1638 reverse gyrase; Provisional 90.33
PF07726131 AAA_3: ATPase family associated with various cellu 90.33
cd01394218 radB RadB. The archaeal protein radB shares simila 90.21
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 90.18
PRK00149450 dnaA chromosomal replication initiation protein; R 90.15
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 90.11
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 90.04
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 90.03
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 89.99
PRK08939306 primosomal protein DnaI; Reviewed 89.97
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 89.94
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 89.94
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 89.94
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 89.89
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 89.82
PHA02624647 large T antigen; Provisional 89.75
TIGR02237209 recomb_radB DNA repair and recombination protein R 89.73
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 89.7
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 89.7
cd01393226 recA_like RecA is a bacterial enzyme which has rol 89.66
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 89.58
PRK13342413 recombination factor protein RarA; Reviewed 89.52
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 89.49
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 89.48
PF13173128 AAA_14: AAA domain 89.45
PRK05642234 DNA replication initiation factor; Validated 89.4
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 89.36
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 89.31
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 89.25
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 89.18
PRK13531 498 regulatory ATPase RavA; Provisional 89.17
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 89.13
PRK10867433 signal recognition particle protein; Provisional 89.12
PHA02244383 ATPase-like protein 89.11
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 89.1
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 88.96
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 88.95
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 88.87
PRK04328249 hypothetical protein; Provisional 88.86
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 88.86
TIGR00959428 ffh signal recognition particle protein. This mode 88.77
PHA02653 675 RNA helicase NPH-II; Provisional 88.71
COG4096 875 HsdR Type I site-specific restriction-modification 88.63
PRK08233182 hypothetical protein; Provisional 88.59
CHL00195489 ycf46 Ycf46; Provisional 88.57
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 88.5
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 88.48
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 88.36
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 88.28
COG2256436 MGS1 ATPase related to the helicase subunit of the 88.25
PRK05541176 adenylylsulfate kinase; Provisional 88.22
PRK00131175 aroK shikimate kinase; Reviewed 88.18
PRK13766 773 Hef nuclease; Provisional 88.12
COG0714329 MoxR-like ATPases [General function prediction onl 88.1
PRK11823446 DNA repair protein RadA; Provisional 88.02
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 87.99
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 87.93
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 87.74
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 87.71
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 87.55
KOG2028554 consensus ATPase related to the helicase subunit o 87.49
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 87.42
PRK03918 880 chromosome segregation protein; Provisional 87.4
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 87.39
PRK05480209 uridine/cytidine kinase; Provisional 87.39
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 87.35
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 87.27
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 87.23
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 87.08
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 87.07
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 86.99
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 86.92
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 86.86
PRK13851344 type IV secretion system protein VirB11; Provision 86.83
PRK09694 878 helicase Cas3; Provisional 86.83
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 86.8
PRK13909 910 putative recombination protein RecB; Provisional 86.61
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 86.56
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 86.55
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 86.51
PRK14088440 dnaA chromosomal replication initiation protein; P 86.47
PRK09302509 circadian clock protein KaiC; Reviewed 86.42
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 86.42
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 86.41
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 86.4
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 86.32
CHL00176 638 ftsH cell division protein; Validated 86.3
PRK13341 725 recombination factor protein RarA/unknown domain f 86.29
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 86.12
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 86.12
PRK14527191 adenylate kinase; Provisional 86.06
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 86.06
PRK14087450 dnaA chromosomal replication initiation protein; P 86.05
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 85.95
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 85.88
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 85.85
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 85.69
PRK13407334 bchI magnesium chelatase subunit I; Provisional 85.67
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 85.64
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 85.49
PRK09112351 DNA polymerase III subunit delta'; Validated 85.49
PRK06762166 hypothetical protein; Provisional 85.47
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 85.21
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 85.2
PRK04040188 adenylate kinase; Provisional 85.18
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 85.17
COG0552340 FtsY Signal recognition particle GTPase [Intracell 85.13
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 85.11
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 85.11
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 85.09
PRK12422445 chromosomal replication initiation protein; Provis 85.05
TIGR02012321 tigrfam_recA protein RecA. This model describes or 85.0
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 84.98
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 84.97
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 84.97
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 84.94
PRK10865857 protein disaggregation chaperone; Provisional 84.85
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 84.79
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 84.78
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 84.76
PRK13764602 ATPase; Provisional 84.73
TIGR02236310 recomb_radA DNA repair and recombination protein R 84.56
PHA02774613 E1; Provisional 84.56
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 84.54
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 84.51
PRK04301317 radA DNA repair and recombination protein RadA; Va 84.45
PRK00889175 adenylylsulfate kinase; Provisional 84.43
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 84.38
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 84.38
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 84.37
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 84.3
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 84.25
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 84.23
PLN02200234 adenylate kinase family protein 83.96
PRK13768253 GTPase; Provisional 83.9
PRK14531183 adenylate kinase; Provisional 83.89
TIGR00235207 udk uridine kinase. Model contains a number of lon 83.84
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 83.82
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 83.79
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 83.76
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 83.55
PRK06696223 uridine kinase; Validated 83.52
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 83.51
PF12846304 AAA_10: AAA-like domain 83.4
COG2255332 RuvB Holliday junction resolvasome, helicase subun 83.4
PRK08118167 topology modulation protein; Reviewed 83.34
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 83.31
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 83.23
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 83.07
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 83.04
PF00005137 ABC_tran: ABC transporter This structure is on hol 83.0
PRK07667193 uridine kinase; Provisional 82.97
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 82.95
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 82.95
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 82.87
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 82.83
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 82.8
PRK03839180 putative kinase; Provisional 82.74
COG1936180 Predicted nucleotide kinase (related to CMP and AM 82.72
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 82.71
cd00983325 recA RecA is a bacterial enzyme which has roles in 82.68
PRK09435332 membrane ATPase/protein kinase; Provisional 82.53
PRK13947171 shikimate kinase; Provisional 82.49
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 82.26
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 82.23
PRK09087226 hypothetical protein; Validated 82.19
PRK07940394 DNA polymerase III subunit delta'; Validated 82.18
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 82.18
PRK06547172 hypothetical protein; Provisional 82.15
PRK14532188 adenylate kinase; Provisional 82.13
COG1198 730 PriA Primosomal protein N' (replication factor Y) 82.07
PRK12608380 transcription termination factor Rho; Provisional 82.03
PRK01184184 hypothetical protein; Provisional 81.97
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 81.89
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 81.89
PRK14528186 adenylate kinase; Provisional 81.84
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 81.82
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 81.79
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 81.78
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 81.69
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 81.66
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 81.66
COG0507696 RecD ATP-dependent exoDNAse (exonuclease V), alpha 81.65
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 81.64
PF07088 484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 81.62
PTZ00202550 tuzin; Provisional 81.59
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 81.55
PRK02496184 adk adenylate kinase; Provisional 81.45
PRK07261171 topology modulation protein; Provisional 81.44
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 81.36
PRK07471365 DNA polymerase III subunit delta'; Validated 81.27
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 81.13
PRK10865 857 protein disaggregation chaperone; Provisional 81.12
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 81.12
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 81.11
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 80.93
cd03112158 CobW_like The function of this protein family is u 80.88
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 80.86
PF13479213 AAA_24: AAA domain 80.86
cd03114148 ArgK-like The function of this protein family is u 80.59
PRK00300205 gmk guanylate kinase; Provisional 80.58
PRK14530215 adenylate kinase; Provisional 80.57
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 80.55
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 80.45
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 80.41
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 80.41
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 80.2
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 80.15
PRK09302 509 circadian clock protein KaiC; Reviewed 80.08
PRK13765 637 ATP-dependent protease Lon; Provisional 80.02
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=3.4e-32  Score=319.93  Aligned_cols=350  Identities=24%  Similarity=0.266  Sum_probs=220.2

Q ss_pred             ccccccCcccCChhHHHHhhhHHHHHHHHHHHHhhhhhcCccccccccceEEEeeeeeCCeEEEEEeecCCCCccccCCC
Q 000592          857 CKLKEVPVCFQSPEQFVSIFRPLVLEEFKAQLHSSFLEMSSWEDMYYGSLSVLSVERVDDFHLVRFVHDDNDSVTSKIFS  936 (1402)
Q Consensus       857 ~kLkkIP~TF~S~eEYi~tFePLLLEE~wAQL~SS~eEiss~E~~~~g~IsVlS~erVDdF~~V~f~~~~~~~~~~~~fs  936 (1402)
                      .+...|-.+|.+..+|.++|.||+-.|+...-  .+.|.     .....+.|.+---.+.-+...|.....  .....+.
T Consensus       227 ~~~~hv~~ry~da~~y~~vf~pliklea~ydk--~~Kes-----~~q~~~tvRW~~gLnkk~~a~f~~~k~--~~e~kl~  297 (935)
T KOG1802|consen  227 EEPPHVQLRYEDAYEYQNVFSPLIKLEADYDK--RLKES-----QTQENGTVRWDIGLNKKRLAYFTLPKL--DSELKLA  297 (935)
T ss_pred             cCCCcccccccchHHHhhhcchhhhhhhhhhh--hhhhh-----cccccceEEeeeccccceEEEEecCCC--cchhccc
Confidence            35667888999999999999999999986543  22221     112223343322233334444544432  2345788


Q ss_pred             CCcEEEEEecCCCCCCCceeEEEEEEeeeccCCCCceEEEEEEEecCCccchhHHHhhhhcccceeeeeeccccHHHHHH
Q 000592          937 ENDLVLLTRVSPQKTPHDVHMVGKVERRERDNNRRSSILLIRFYLQNGSVRLNQARRNLLERSKWHATLIMSITPQLREF 1016 (1402)
Q Consensus       937 EGDLVLLSk~~P~~s~~~~~~LGkVer~e~d~~k~~~iL~LR~~l~n~ssrLnq~~~~Lt~~S~w~~~KL~SLTTilREy 1016 (1402)
                      .||-+.|+.+......  ..-+|.|.+.-.. ......+.+++...   .+.       ..++.+.+..+-+-+++.|++
T Consensus       298 ~GdE~~L~y~~~~~~~--w~~~g~v~~~pd~-~~dE~~lEl~~~~~---~p~-------e~~~~Ftvd~vwk~ts~drm~  364 (935)
T KOG1802|consen  298 IGDEIRLTYSGGLVLP--WNGIGSVLKIPDN-NGDEVKLELEFSQD---PPI-------EVTHGFTVDFVWKSTSFDRMQ  364 (935)
T ss_pred             cCCeeEEEecCCcCCc--ccccceEEecCCC-CcceeEEEeecCCC---CCc-------ccccceEEEEEEcCccHHHHH
Confidence            9999999876543221  3447888766432 22233344444321   111       123446666777889999999


Q ss_pred             HhhccCCC-------CCCcccccCCCCCCCCCCCcccccccchhH-HHHHhhcCCCHHHHHHHHHHHccCCCCcCCCceE
Q 000592         1017 HALSSLKS-------IPLLPIILNPVNVSRGYNESRELDLGKLSQ-LQQILKTSFNESQLQAISVAIGLSSSWKKDCELS 1088 (1402)
Q Consensus      1017 ~AL~sL~~-------lPL~~~ILsP~~~~~~~~e~~~~~l~ki~~-L~~~Lk~~lNeSQ~qAI~sAL~~~~~~~k~~gfs 1088 (1402)
                      .||..|..       |-+...+-.|......        ...+|. +-..--.+||.||..|+..+|++        +++
T Consensus       365 ~alk~la~D~~~vs~y~y~klLgh~~~~~~~--------k~~LP~~~s~~~lpkLN~SQ~~AV~~VL~r--------pls  428 (935)
T KOG1802|consen  365 LALKLLAVDEKKVSGYLYHKLLGHPVEDSSL--------KKLLPRRFSVPNLPKLNASQSNAVKHVLQR--------PLS  428 (935)
T ss_pred             HHHHHhhhccccchhhhhhHHhcCcchhhhh--------cccCchhhcCCCchhhchHHHHHHHHHHcC--------Cce
Confidence            99987642       2222222223222100        011221 10000137999999999999976        699


Q ss_pred             EEEcCCCCChhhHHHHHHHHHHHhcCCCCcccccCcccccCCCCccchhHHHHHHHHHHHHHhhhccccccccccccccC
Q 000592         1089 LIQGPPGTGKTRTIVAIVSALLATRTSPKSHLKQNYSSCINSRPKIGQSAAIARAWQDAALARQINEDSERDKKSSESSV 1168 (1402)
Q Consensus      1089 LIQGPPGTGKTkTIvgLVsaLL~~~~~~~s~~~p~~Ss~~~~rp~~s~~~~~ar~W~d~a~arq~~~d~~~~~~~~~~~~ 1168 (1402)
                      |||||||||||.|+..||..|....                                                       
T Consensus       429 LIQGPPGTGKTvtsa~IVyhl~~~~-------------------------------------------------------  453 (935)
T KOG1802|consen  429 LIQGPPGTGKTVTSATIVYHLARQH-------------------------------------------------------  453 (935)
T ss_pred             eeecCCCCCceehhHHHHHHHHHhc-------------------------------------------------------
Confidence            9999999999999999999887652                                                       


Q ss_pred             CCeEEEEeCchHHHHHHHHHHHhcCCCCCCCCccCCcEEEeccccc--ccCCCccccHHHHHHHHHHHhhhccCCCcccc
Q 000592         1169 RARVLICAQSNAAVDELVSRISKEGLYGSDGKTYKPYLVRVGNVKT--VHPNSLPFFIDTLVDHRLAEERMHLTDPKNEF 1246 (1402)
Q Consensus      1169 k~RILVCAPSNAAVDEIV~RLl~~GI~d~dGk~y~P~VVRVG~~~a--v~s~v~~vsLD~LVeqrLs~~~~~~~~sk~~~ 1246 (1402)
                      ..+||||||||.|||+|+++|.+.|+          +|||+-...+  +.++|..++|.++++..      .        
T Consensus       454 ~~~VLvcApSNiAVDqLaeKIh~tgL----------KVvRl~aksRE~~~S~vs~L~lh~~~~~~------~--------  509 (935)
T KOG1802|consen  454 AGPVLVCAPSNIAVDQLAEKIHKTGL----------KVVRLCAKSREDIESDVSFLSLHEQLRNM------D--------  509 (935)
T ss_pred             CCceEEEcccchhHHHHHHHHHhcCc----------eEeeeehhhhhhccCCccHHHHHHHHhcc------C--------
Confidence            46899999999999999999999887          7999998654  34445555555554311      0        


Q ss_pred             cccchHHHHHHHHHHHHHHHHHHhhhcccCCCCCCCCccccccccCCCCcCchHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000592         1247 CTRSSTLRSNLEKLVDRIRFFEAKRANTKDGNSDPKNMLDDEVHKGDDVKLSDVELEAKLRKLYEQKKQIYRELGVAQVQ 1326 (1402)
Q Consensus      1247 ~~~ss~Lrs~Le~L~~ei~~~ea~R~~l~~~~~~~k~~l~~e~~g~d~~~ls~~el~~kL~~L~eqR~qL~~eL~~~~~~ 1326 (1402)
                             ..+|+++.+.       +.+                 +   ++++..                          
T Consensus       510 -------~pELq~l~kl-------kde-----------------~---gelS~s--------------------------  529 (935)
T KOG1802|consen  510 -------KPELQKLLKL-------KDE-----------------G---GELSSS--------------------------  529 (935)
T ss_pred             -------cHHHHHHHhh-------hhh-----------------c---ccccch--------------------------
Confidence                   0122222110       000                 0   011000                          


Q ss_pred             HhhHHHHHHHHHHHHHHHHhccCcEEEEeCCCCCcCccccccccccccccCCCCCCCCCCEEEEecCcccccccCC
Q 000592         1327 EKKSYEETKALKHKLRKSILKEAEIVVTTLSGCGGDLYGVCSESVSGFKFGNPSENTLFDAVVIDEAAQVVLVHEL 1402 (1402)
Q Consensus      1327 ek~~~~e~~~lRrrir~~IL~eAdIVCSTLSGSG~dll~~c~et~aa~kf~~~~~~~~FDtVIIDEAAQAvElStL 1402 (1402)
                         -....+.+.++...++|..|||||||+.|+|...|.                ..+|.+||||||+||.||++|
T Consensus       530 ---D~~k~~~lk~~~e~ell~~AdVIccTcv~Agd~rl~----------------~~kfr~VLiDEaTQatEpe~L  586 (935)
T KOG1802|consen  530 ---DEKKYRKLKRAAEKELLNQADVICCTCVGAGDRRLS----------------KFKFRTVLIDEATQATEPECL  586 (935)
T ss_pred             ---hhHHHHHHHHHHHHHHHhhcCEEEEecccccchhhc----------------cccccEEEEecccccCCcchh
Confidence               001233456778899999999999999999986653                368999999999999999986

>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG1807 consensus Helicases [Replication, recombination and repair] Back     alignment and domain information
>KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>KOG1804 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR00609 recB exodeoxyribonuclease V, beta subunit Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK10876 recB exonuclease V subunit beta; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13909 putative recombination protein RecB; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1402
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 5e-24
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 2e-06
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 6e-05
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 5e-21
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 8e-08
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 1e-17
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 3e-05
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 2e-04
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 5e-04
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 Back     alignment and structure
 Score =  108 bits (271), Expect = 5e-24
 Identities = 56/268 (20%), Positives = 92/268 (34%), Gaps = 46/268 (17%)

Query: 851  DENRVHCKLKEVPVCFQSPEQFVSIFRPLVLEEFKAQLHSSFLEMSSWEDMYYGSLSVLS 910
            D       +  + + +Q   ++   + PL+  E               E      +SV  
Sbjct: 169  DAPEEQEAIPPLLLRYQDAYEYQRSYGPLIKLEADYDKQLK-------ESQALEHISVSW 221

Query: 911  VERVDDFHLVRFVHDDNDSVTSKIFSENDLVLLTRVSPQKTPHD-VHMVGKVERRERDNN 969
               +++ HL  F     +S   K+ +  D ++L     Q    +    + ++    +D  
Sbjct: 222  SLALNNRHLASFTLSTFESNELKV-AIGDEMILWYSGMQHPDWEGRGYIVRLPNSFQD-- 278

Query: 970  RRSSILLIRFYLQNGSVRLNQARRNLLERSKWHATLIMSITPQLREFHALSSLK------ 1023
                     F L+   ++ ++        + + A  I   T   R   AL          
Sbjct: 279  --------TFTLE---LKPSKTPPPTHLTTGFTAEFIWKGTSYDRMQDALKKFAIDKKSI 327

Query: 1024 SIPLLPIIL--NPVNVSRGYNESRELDLGKLSQLQQILKTSFNESQLQAISVAIGLSSSW 1081
            S  L   IL    V++S      +E  +   +QL        N SQ  A+S  +      
Sbjct: 328  SGYLYYKILGHQVVDISFDVPLPKEFSIPNFAQL--------NSSQSNAVSHVL------ 373

Query: 1082 KKDCELSLIQGPPGTGKTRTIVAIVSAL 1109
                 LSLIQGPPGTGKT T   IV  L
Sbjct: 374  --QRPLSLIQGPPGTGKTVTSATIVYHL 399
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Length = 608 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Length = 459 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Length = 574 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1402
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 99.43
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 99.34
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 99.13
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 98.94
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 98.0
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 97.62
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 97.42
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.3
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.16
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.12
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 97.07
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 97.06
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.02
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.86
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.84
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.78
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.76
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.75
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.72
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.7
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 96.7
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 96.61
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.58
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.5
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 96.49
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.36
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.33
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.32
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.28
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.25
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.15
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 95.95
d1svma_362 Papillomavirus large T antigen helicase domain {Si 95.91
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 95.87
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.86
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.85
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 95.77
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 95.7
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.68
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.55
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.52
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.49
d2qy9a2211 GTPase domain of the signal recognition particle r 95.42
d1okkd2207 GTPase domain of the signal recognition particle r 95.42
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 95.38
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 95.26
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 94.98
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.97
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.81
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.77
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 94.61
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.47
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 94.05
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 93.84
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.72
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 93.67
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 93.4
d1vmaa2213 GTPase domain of the signal recognition particle r 93.36
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 93.33
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 93.01
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.99
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 92.99
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 92.9
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 92.85
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 92.78
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 92.71
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 92.54
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 92.45
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 92.44
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 92.36
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 92.19
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 91.98
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 91.96
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 91.79
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 91.67
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 91.65
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 91.44
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 91.41
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 91.38
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 91.36
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 91.34
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 91.24
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 91.19
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 91.01
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 90.97
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 90.97
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 90.77
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 90.47
d1tuea_205 Replication protein E1 helicase domain {Human papi 90.44
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 90.39
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 90.39
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 90.32
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 90.22
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 90.13
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 89.71
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 89.63
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 89.62
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 88.71
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 88.35
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 88.29
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 87.86
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 87.79
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 87.7
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 87.5
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 87.27
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 87.13
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 86.27
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 85.98
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 85.93
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 85.88
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 85.68
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 85.63
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 85.39
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 85.31
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 85.18
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 85.12
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 84.53
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 83.72
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 81.93
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 81.39
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 81.39
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 81.09
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 80.74
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Exodeoxyribonuclease V alpha chain (RecD)
species: Escherichia coli [TaxId: 562]

Probab=99.43  E-value=3.1e-13  Score=103.48  Aligned_cols=71  Identities=31%  Similarity=0.441  Sum_probs=59.7

Q ss_pred             CCCCHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             17999999999999703899867876289976899980568999999999712899754455766555788766503899
Q 000592         1061 TSFNESQLQAISVAIGLSSSWKKDCELSLIQGPPGTGKTRTIVAIVSALLATRTSPKSHLKQNYSSCINSRPKIGQSAAI 1140 (1402)
Q Consensus      1061 ~~LNeSQlqAI~sAL~~s~~~~k~~~iTLIQGPPGTGKTkTIvgLIsaLL~~~~~~~s~~~p~~ss~~~~Rp~~s~~~~v 1140 (1402)
                      ..+++.|..|+..++..        +|++|+||||||||+|+..++.+++...                           
T Consensus       147 ~~~~~~Q~~A~~~al~~--------~~~vI~G~pGTGKTt~i~~~l~~l~~~~---------------------------  191 (359)
T d1w36d1         147 SDEINWQKVAAAVALTR--------RISVISGGPGTGKTTTVAKLLAALIQMA---------------------------  191 (359)
T ss_dssp             TTSCCHHHHHHHHHHTB--------SEEEEECCTTSTHHHHHHHHHHHHHHTC---------------------------
T ss_pred             CCCCCHHHHHHHHHHCC--------CEEEEECCCCCCCEEHHHHHHHHHHHHH---------------------------
T ss_conf             65663899999999708--------8599976898875216999999999987---------------------------


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             989887998743123321123565565787299992743899999999982
Q 000592         1141 ARAWQDAALARQINEDSERDKKSSESSVRARVLICAQSNAAVDELVSRISK 1191 (1402)
Q Consensus      1141 ar~W~d~a~arql~~d~~~~~~~s~~~~k~RILVCAPSNAAVDEIV~RLl~ 1191 (1402)
                                               ...+.+|++|||||.|.+++..++..
T Consensus       192 -------------------------~~~~~~I~l~ApTgkAA~~L~e~~~~  217 (359)
T d1w36d1         192 -------------------------DGERCRIRLAAPTGKAAARLTESLGK  217 (359)
T ss_dssp             -------------------------SSCCCCEEEEBSSHHHHHHHHHHHTH
T ss_pred             -------------------------HCCCCEEEEECCCHHHHHHHHHHHHH
T ss_conf             -------------------------52698289843759999999988877
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure