Citrus Sinensis ID: 000720

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330---

MGYFQNLELVSADKVLESVNVAFFIGLFTRLWIEILKRRRDDGYILMARRAAGLVIVLCNVLIFILYMGFGFYEYWNFRIVSFKSVSLVVTWALATVVALCSRYYRTLGEHKRWPLVLVLWWVVHLVIVLVCVSVYLLTHLSSIGLPHILPEAKAVDFVSLPLLVLLCFNATYACCCARDPSDLDIPLLREEDDEFLCKNISTFASAGVLSKITFHWLNQLFQRGRIQKLELLHIPPIPQSETANDASSLLEESLRKQKTDATSLPQVIIHAVWKSLALNAAFAGVNTIASYIGPFLITNFVSFLSGKHDHSSYHYGLVLASVFLFAKTVESLTQRQWYFGANRIGIRVRSALTVLIYKRSMAIKFAGPSSGIIINMINVDVERIGDFFLYIHRIWLLPVQVFLALVILYKNLGAAPAFAALFSTIFVMVSNTPLANRQERFHSMIMEAKDARIKATSETLKSMRVLKLLSWEQEFLKKLLRLREIERDSLKKYLYTCSAIAFLFWASPTLVSVITFGVCILLKTPLTSGAVLSALATFRILQEPIYNLPELISMIAQTKVSLYRIQEFIKEDNQKKPITEPTSKASDVAIDIEAGEYAWDAREENFKKPTIKLTDKMKIMKGSKVAVCGSVGSGKSSLLSSILGEIPRISGAAIKVHGKKAYVPQSSWIQTGTIRENILFGKDMRQSFYEEVLEGCALNQDIEMWADGDLSVVGERGINLSGGQKQRIQLARAVYSNSDVYIFDDPFSAVDAHTGTHLFKQCLMGLLSQKTVLYTTHQLEFLDAADLVLVMKDGKIEQSGKYEDLIADQNSELVRQMKAHRKSLDQVNPPQEDKCLSRVPCQMSQITEERFARPISCGEFSGRSQDEDTELGRVKWTVYSAFITLVYKGALVPVILLCQVLFQALQMGSNYWIAWATDEKRKVSREQLIGVFIFLSGGSSFFILGRAVLLATIAIKTAQRLFLNMITSVFRAPISFFDSTPSSRILNRCSTDQSTVDTDIPYRLAGLAFALIQLLSIIILMSQAAWQVFPLFLVILGISIWYQAYYITTARELARMVGTRKAPILHHFSESIAGATTIRCFNQENRFLLRSHSLIDDYSCVTFHNCGTMEWLCLRINLLFNFAFFLVLIILVTLPRSAIDPSLAGLAATYGLNLNVLQAWVIWNLCNVENKMISVERILQFTNIPSEAPLVIKNSRPSPEWPSSGKIELENLLVQYNPTLPMVLKGITCTFPGEKKIGVVGRTGSGKSTLIQALFRVVEPSGGRILIDGVDISMIGLQDLRSRLSIIPQDPMLFQGTVRTNLDPLEQHSDQEIWEVKISKLLTHKSYQCEYT

ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEEEEEcccccccccccccccccEEECcccEEEEEccccccHHHHHHHHHcccccccccEEEEccEEEEEccccccccccccccccccccccHHHHHHHHHHHccHHHHHHccccccccccccccccccHHHHHHHHHHHHcccccEEEEcccccHccHHHHHHHHHHHHHHHccccEEEEEcccccccccccEEEEEEccEEEEcccHHHHHHcccHHHHHHHHHHHHcccccccccccccccccccccccHHHHccccccccccccccccccHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEEEEcccccccccccEEEEccccEEEEEccccccHHHHHHHHHHcccccccEEEEcccccccccHHHHHccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccc

*GYFQNLELVSADKVLESVNVAFFIGLFTRLWIEILKRRRDDGYILMARRAAGLVIVLCNVLIFILYMGFGFYEYWNFRIVSFKSVSLVVTWALATVVALCSRYYRTLGEHKRWPLVLVLWWVVHLVIVLVCVSVYLLTHLSSIGLPHILPEAKAVDFVSLPLLVLLCFNATYACCCARDP***DIPLLR******LCKNISTFASAGVLSKITFHWLNQLFQRGRIQKLELLHIPPIPQSETANDASSLLEESLRKQKTDATSLPQVIIHAVWKSLALNAAFAGVNTIASYIGPFLITNFVSFLSGKHDHSSYHYGLVLASVFLFAKTVESLTQRQWYFGANRIGIRVRSALTVLIYKRSMAIKFAGPSSGIIINMINVDVERIGDFFLYIHRIWLLPVQVFLALVILYKNLGAAPAFAALFSTIFVMVSNTPLANRQERFHSMIMEAKDARIKATSETLKSMRVLKLLSWEQEFLKKLLRLREIERDSLKKYLYTCSAIAFLFWASPTLVSVITFGVCILLKTPLTSGAVLSALATFRILQEPIYNLPELISMIAQTKVSLYRIQEFIKED***************VAIDIEAGEYAWDAREENFKKPTIKLTDKMKIMKGSKVAVCGSVGSGKSSLLSSILGEIPRISGAAIKVHGKKAYVPQSSWIQTGTIRENILFGKDMRQSFYEEVLEGCALNQDIEMWADGDLSVVGERGINLSGGQKQRIQLARAVYSNSDVYIFDDPFSAVDAHTGTHLFKQCLMGLLSQKTVLYTTHQLEFLDAADLVLVMKDGKIEQSGKYEDLIADQNSE***********************************************************GRVKWTVYSAFITLVYKGALVPVILLCQVLFQALQMGSNYWIAWATDEKRKVSREQLIGVFIFLSGGSSFFILGRAVLLATIAIKTAQRLFLNMITSVFRAPISFFDSTPSSRILNRCSTDQSTVDTDIPYRLAGLAFALIQLLSIIILMSQAAWQVFPLFLVILGISIWYQAYYITTARELARMVGTRKAPILHHFSESIAGATTIRCFNQENRFLLRSHSLIDDYSCVTFHNCGTMEWLCLRINLLFNFAFFLVLIILVTLPRSAIDPSLAGLAATYGLNLNVLQAWVIWNLCNVENKMISVERILQFTNIPSEAPLVI********WPSSGKIELENLLVQYNPTLPMVLKGITCTFPGEKKIGVVGRTGSGKSTLIQALFRVVEPSGGRILIDGVDISMIGLQDLRSRLSIIPQDPMLFQGTVRTNLDPLEQHSDQEIWEVKISKLLTHKSY*****

xxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ABC transporter C family member 3	Pump for glutathione S-conjugates. Mediates the transport of glutathione conjugates such as chlorodinitrobenzene-GS (DNB-GS), and of chlorophyll catabolites such as Bn-NCC-1. Transports also heavy metals such as cadmium (Cd).	probable	Q9LK64
Canalicular multispecific organic anion transporter 2	May act as an inducible transporter in the biliary and intestinal excretion of organic anions. Acts as an alternative route for the export of bile acids and glucuronides from cholestatic hepatocytes.	probable	O88563

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CBZ, chain A
Confidence level:very confident
Coverage over the Query: 590-824
View the alignment between query and template
View the model in PyMOL

Template: 3G5U, chain A
Confidence level:very confident
Coverage over the Query: 338-823
View the alignment between query and template
View the model in PyMOL

Template: 3G5U, chain A
Confidence level:confident
Coverage over the Query: 338-823
View the alignment between query and template
View the model in PyMOL

Template: 3B5X, chain A
Confidence level:confident
Coverage over the Query: 877-1316
View the alignment between query and template
View the model in PyMOL