Citrus Sinensis ID: 000833

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260---

MVMESADDSASPGSRKWPRLFIKEMVMRNFKSYAGEQRVGPFHKSFSAVVGPNGSGKSNVIDAMLFVFGKRAKQMRLNKVSELIHNSTNYQNLDSAGVSVHFQEIVDLDDGTYEAIQGSDFVISRVAFRDNSSKYYINDRPSNFTEVTKKLKGKGVDLDNNRFLILQGEVEQISLMKPKGQGPHDEGFLEYLEDIIGTDRYVEKIDESYKDYVVLFDLIGLNHSMRNVPVLFKWLNWQRKKEIAWRFVCVSVLDVKNEAEAYMLKELSLLKWQEKATNLAYEDTSLKIVELQENVSKLEENLKNEREKIQDNNKTLKELESVHNKYMRRQEELDNDLRVSKEEFKEFERQDVKYREDSKHMKQKIKKLEVKVEKDSSKIDDLTKECEHATNQIPKLEENIPKLLKLFENVFIADTQNIITFPFMNMINLCVETERYRSELATVRAELEPWEKELIVHKGKLEVTCTESKLLCEKHEAGRKAFEDAQRQMDDILRRIDTKTTAIRNMQGDLEKNKLEAMEAHNVEQECFKEQETLIPLEQAARQKVAELKSVMDSEKSQGSVLKAILQAKESNQIEGIYGRMGDLGAIDAKYDIAVSTACPGLDYIVVETTSAAQACVELLRREKLGVATFMILEKQVDLFPKMKEHFSTPENVPRLFDLIKVKDERMKLAFYAAMGNTLVAKDLDQATRIAYSGNKEFRRVVTLDGALFEKSGTMSGGGSKPRGGKMGTSIRPTSVSAEAIINAEKELSAMVDNLSRIRQKIADAVKHYQASEKAVAHLEMELAKSRKEIESLKSQHSYLEKQLDSLKAASEPRKDEIDRLEELQKIISAEEKEIEKIVNGSKDLKEKALQLQSKVENAGGEKLKAQKLKVDKIQSDIDKSSTEINRHKVQIETAQKMIKKLTKGIAESKKEKEQLVEERVKMERIFDEILEKAHNVQEHYTNTQKLIDQHRDVLDKAKNDYEKLKKTVDELRASEIEADYKLQDLKRSYKELEMRGKGYKKRLDDLQITLLKHLEQIQKDLVDPEKLQATLADQTLSDACDLKRTLEMVALLEAQLKELNPNLDSITEYRRKVAAYNERVEDLTTVTQQRDDVKKQYDEWRKKRLDEFMAGFNAISLKLKEMYQMITLGGDAELELVDSLDPFSEGVVFSVRPPKKSWKNIANLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFKNVSIVGHYVKDRTKDAQFIIISLRNNMFELADRLVGIYKTDNCTKSITINPGSFTVCENAA

cccccccccccccccccccEEEEEEEEcccccccccEEEcccccccEEEEcccccccHHHHHHHHHHHcccccHHHHcccccEEEcccccccccccEEEEEEEEEEcccccccccccccEEEEEEEEEEcccCEEEEccccccHHHHHHHHHHccccccccccccccHHHHHHHcccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEECccccccccHHHHHHHHHHccccccEEEccHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHccEEEEccHHHHHHHHHcccccccEEEEcccEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccCEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEccccccccccccHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHEEEEccccEEEEEECccccccHcccc

****************WPRLFIKEMVMRNFKSYAGEQRVGPFHKSFSAVVGPNGSGKSNVIDAMLFVFGKRAKQMRLNKVSELIHNSTNYQNLDSAGVSVHFQEIVDLDDGTYEAIQGSDFVISRVAFRDNSSKYYINDRPSNFTEVTKKLKGKGVDLDNNRFLILQGEVEQISLM********DEGFLEYLEDIIGTDRYVEKIDESYKDYVVLFDLIGLNHSMRNVPVLFKWLNWQRKKEIAWRFVCVSVLDVKNEAEAYMLKELSLLKWQEKATNLAYEDTSLKIVEL*****************************************************************************************************IPKLEENIPKLLKLFENVFIADTQNIITFPFMNMINLCVETERYRSELATVRAELEPWEKELIVHKGKLEVTCTESKLLCEKH****************************************************************************************AILQAKESNQIEGIYGRMGDLGAIDAKYDIAVSTACPGLDYIVVETTSAAQACVELLRREKLGVATFMILEKQVDLFPKMKEHFSTPENVPRLFDLIKVKDERMKLAFYAAMGNTLVAKDLDQATRIAYSGNKEFRRVVTLDGALFEKSG*****************************************LSRIRQKIADAVKH**********************************************************************************************************************************************************MERIFDEILEKAHNVQEHYTNTQKLIDQHRDVL*************************YKL***********MRGKGYKKRLDDLQITLLKHLEQIQKDLVDPEKLQATLADQTLSDACDLKRTLEMVALLEAQLKELNPNLDSITEYRRKVAAYNERVEDLTTVTQQRDDVKKQYDEWRKKRLDEFMAGFNAISLKLKEMYQMITLGGDAELELVDSLDPFSEGVVFSVRPPKKSWKNIANLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFKNVSIVGHYVKDRTKDAQFIIISLRNNMFELADRLVGIYKTDNCTKSITINPGSFTVC****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVMESADDSASPGSRKWPRLFIKEMVMRNFKSYAGEQRVGPFHKSFSAVVGPNGSGKSNVIDAMLFVFGKRAKQMRLNKVSELIHNSTNYQNLDSAGVSVHFQEIVDLDDGTYEAIQGSDFVISRVAFRDNSSKYYINDRPSNFTEVTKKLKGKGVDLDNNRFLILQGEVEQISLMKPKGQGPHDEGFLEYLEDIIGTDRYVEKIDESYKDYVVLFDLIGLNHSMRNVPVLFKWLNWQRKKEIAWRFVCVSVLDVKNEAEAYMLKELSLLKWQEKATNLAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDVKYREDSKHMKQKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIPKLLKLFENVFIADTQNIITFPFMNMINLCVETERYRSELATVRAELEPWEKELIVHKGKLEVTCTESKLLCEKHEAGRKAFEDAQRQMDDILRRIDTKTTAIRNMQGDLEKNKLEAMEAHNVEQECFKEQETLIPLEQAARQKVAELKSVMDSEKSQGSVLKAILQAKESNQIEGIYGRMGDLGAIDAKYDIAVSTACPGLDYIVVETTSAAQACVELLRREKLGVATFMILEKQVDLFPKMKEHFSTPENVPRLFDLIKVKDERMKLAFYAAMGNTLVAKDLDQATRIAYSGNKEFRRVVTLDGALFEKSGTMSGGGSKPRGGKMGTSIRPTSVSAEAxxxxxxxxxxxxxxxxxxxxxIADAVKHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSEPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKLKAQKLKVDKIQSDIDKSSTEINRHKVQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAHNVQEHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEIEADYKxxxxxxxxxxxxxxxxxxxxxxxxxxxxLLKHLEQIQKDLVDPEKLQATLADQTLSDACDLKRTLEMVALLEAQLKELNPNLDSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRLDEFMAGFNAISLKLKEMYQMITLGGDAELELVDSLDPFSEGVVFSVRPPKKSWKNIANLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFKNVSIVGHYVKDRTKDAQFIIISLRNNMFELADRLVGIYKTDNCTKSITINPGSFTVCENAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Structural maintenance of chromosomes protein 4	Central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. Also involved in chromosome segregation in meiosis.	confident	Q9FJL0
Structural maintenance of chromosomes protein 4	Central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.	probable	Q12267
Structural maintenance of chromosomes protein 4	Central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.	probable	Q9NTJ3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L51, chain B
Confidence level:very confident
Coverage over the Query: 559-724
View the alignment between query and template
View the model in PyMOL

Template: 1W1W, chain A
Confidence level:very confident
Coverage over the Query: 1077-1099,1112-1136,1149-1256
View the alignment between query and template
View the model in PyMOL

Template: 2WD5, chain A
Confidence level:very confident
Coverage over the Query: 560-730,745-752
View the alignment between query and template
View the model in PyMOL

Template: 1W1W, chain A
Confidence level:confident
Coverage over the Query: 1077-1099,1112-1136,1149-1256
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 743-814
View the alignment between query and template
View the model in PyMOL

Template: 3AUY, chain A
Confidence level:probable
Coverage over the Query: 22-211,238-275,287-358
View the alignment between query and template
View the model in PyMOL

Template: 3QF7, chain A
Confidence level:probable
Coverage over the Query: 22-299
View the alignment between query and template
View the model in PyMOL