Citrus Sinensis ID: 000833
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1263 | ||||||
| 224140989 | 1256 | condensin complex components subunit [Po | 0.980 | 0.986 | 0.777 | 0.0 | |
| 296082911 | 1253 | unnamed protein product [Vitis vinifera] | 0.973 | 0.981 | 0.775 | 0.0 | |
| 359489002 | 1486 | PREDICTED: structural maintenance of chr | 0.973 | 0.827 | 0.778 | 0.0 | |
| 255587856 | 1259 | Structural maintenance of chromosome, pu | 0.980 | 0.983 | 0.765 | 0.0 | |
| 356573489 | 1242 | PREDICTED: structural maintenance of chr | 0.976 | 0.992 | 0.757 | 0.0 | |
| 356550968 | 1319 | PREDICTED: structural maintenance of chr | 0.975 | 0.934 | 0.764 | 0.0 | |
| 357517581 | 1252 | Structural maintenance of chromosomes pr | 0.973 | 0.982 | 0.724 | 0.0 | |
| 334188261 | 1244 | structural maintenance of chromosomes pr | 0.969 | 0.984 | 0.721 | 0.0 | |
| 15239023 | 1241 | structural maintenance of chromosomes pr | 0.967 | 0.984 | 0.719 | 0.0 | |
| 46981263 | 1241 | putative SMC protein [Oryza sativa Japon | 0.964 | 0.981 | 0.682 | 0.0 |
| >gi|224140989|ref|XP_002323859.1| condensin complex components subunit [Populus trichocarpa] gi|222866861|gb|EEF03992.1| condensin complex components subunit [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 1980 bits (5129), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 995/1280 (77%), Positives = 1110/1280 (86%), Gaps = 41/1280 (3%)
Query: 1 MVMESADD-----------SASPGSRKWPRLFIKEMVMRNFKSYAGEQRVGPFHKSFSAV 49
M MES DD +++ GS K PRLFIKEM+MRNFKSYAGEQRVGPFHKSFSAV
Sbjct: 1 MGMESGDDEFMTSESNSVRTSAGGSSKAPRLFIKEMIMRNFKSYAGEQRVGPFHKSFSAV 60
Query: 50 VGPNGSGKSNVIDAMLFVFGKRAKQMRLNKVSELIHNSTNYQNLDSAGVSVHFQEIVDLD 109
VGPNGSGKSNVIDAMLFVFGKRAKQMRLNKVSELIHNSTN+QNLDSAGVSVHFQEI+DLD
Sbjct: 61 VGPNGSGKSNVIDAMLFVFGKRAKQMRLNKVSELIHNSTNHQNLDSAGVSVHFQEIIDLD 120
Query: 110 DGTYEAIQGSDFVISRVAFRDNSSKYYINDRPSNFTEVTKKLKGKGVDLDNNRFLILQGE 169
DGTYEA+ GSDFVI+RVAFRDNSSKYYINDR SNFTEVTKKLKGKGVDLDNNRFLILQGE
Sbjct: 121 DGTYEAVSGSDFVITRVAFRDNSSKYYINDRSSNFTEVTKKLKGKGVDLDNNRFLILQGE 180
Query: 170 VEQISLMKPKGQGPHDEGFLEYLEDIIGTDRYVEKIDESYKDYVVLFDLIGLNHSMRNVP 229
VEQISLM+PK QG HDEGFLEYLEDIIGT++YVEKIDES K+ L LN V
Sbjct: 181 VEQISLMRPKAQGLHDEGFLEYLEDIIGTNKYVEKIDESSKE------LESLNEKRSGVV 234
Query: 230 VLFKWLNWQRKKEIAWRFVCVSVLDVKNEAEAYMLKELSLLKWQEKATNLAYEDTSLKIV 289
+ K +R S+ DVKNEAEAYML+ELSLLKWQEKAT LA+EDTS +++
Sbjct: 235 QMVKLAEKERD----------SLEDVKNEAEAYMLQELSLLKWQEKATKLAHEDTSARMM 284
Query: 290 ELQENVSKLEENLKNEREKIQDNNKTLKELESVHNKYMRRQEELDNDLRVSKEEFKEFER 349
EL +VS LEENLK EREKIQ+++KT+KELE VH KY++RQEELDNDLR KEEFKEFER
Sbjct: 285 ELHTSVSSLEENLKAEREKIQESHKTMKELEIVHKKYIKRQEELDNDLRTCKEEFKEFER 344
Query: 350 QDVKYREDSKHMKQKIKKLEVKVEKDSSKIDDLTKECEHATNQIPKLEENIPKLLKLFEN 409
QDVKYRED KHMKQK+KKLE K+EKDSSKIDDLTKECE++ N IPKLE+NIPKL KL
Sbjct: 345 QDVKYREDLKHMKQKMKKLEDKLEKDSSKIDDLTKECENSANLIPKLEDNIPKLQKL--- 401
Query: 410 VFIADTQNIITFPFMNMINLCVETERYRSELATVRAELEPWEKELIVHKGKLEVTCTESK 469
+ N ETERYRSEL VRAELEPWEK+LI HKGKLEV TESK
Sbjct: 402 -----LLEEERMLEEVVENSKGETERYRSELVKVRAELEPWEKQLIDHKGKLEVAFTESK 456
Query: 470 LLCEKHEAGRKAFEDAQRQMDDILRRIDTKTTAIRNMQGDLEKNKLEAMEAHNVEQECFK 529
LL EKHEAGR AFE+A +QMD+I I+ KT I +Q ++EK+KLEA EA VEQE K
Sbjct: 457 LLNEKHEAGRAAFENAHKQMDNISGSIEMKTATIAKLQSNIEKHKLEASEARKVEQESIK 516
Query: 530 EQETLIPLEQAARQKVAELKSVMDSEKSQGSVLKAILQAKESNQIEGIYGRMGDLGAIDA 589
EQE LIPLEQAARQKVAELKS++D EKSQGSVLKAIL AKESN+I GI+GRMGDLGAIDA
Sbjct: 517 EQEELIPLEQAARQKVAELKSIIDLEKSQGSVLKAILHAKESNEIRGIHGRMGDLGAIDA 576
Query: 590 KYDIAVSTACPGLDYIVVETTSAAQACVELLRREKLGVATFMILEKQVDLFPKMKEHFST 649
KYD+A+STACPGLDYIVVETT+AAQACVELLRREKLGVATFMILEKQVD KMK + ST
Sbjct: 577 KYDVAISTACPGLDYIVVETTAAAQACVELLRREKLGVATFMILEKQVDHSSKMKHNVST 636
Query: 650 PENVPRLFDLIKVKDERMKLAFYAAMGNTLVAKDLDQATRIAYSGNKEFRRVVTLDGALF 709
PE VPRLFDL++V+DERMKLAFYAA+GNT+VAKDLDQATRIAY GN EFRRVVTLDGALF
Sbjct: 637 PEGVPRLFDLVRVQDERMKLAFYAALGNTVVAKDLDQATRIAYGGNLEFRRVVTLDGALF 696
Query: 710 EKSGTMSGGGSKPRGGKMGTSIRPTSVSAEAIINAEKELSAMVDNLSRIRQKIADAVKHY 769
EKSGTMSGGG+KPRGGKMGTSIR TSVS EA+ +AEKELS MVD L+ IRQ+IAD+VKHY
Sbjct: 697 EKSGTMSGGGTKPRGGKMGTSIRATSVSGEAVTSAEKELSTMVDRLNGIRQRIADSVKHY 756
Query: 770 QASEKAVAHLEMELAKSRKEIESLKSQHSYLEKQLDSLKAASEPRKDEIDRLEELQKIIS 829
QASEKA+AHLEMELAKS+KEI+SL ++HSYLEKQL SLKAASEP+KDE+DRLEEL++II
Sbjct: 757 QASEKAIAHLEMELAKSQKEIDSLNTEHSYLEKQLGSLKAASEPKKDELDRLEELKRIIV 816
Query: 830 AEEKEIEKIVNGSKDLKEKALQLQSKVENAGGEKLKAQKLKVDKIQSDIDKSSTEINRHK 889
EEKEI++++ GSK LKEKAL+LQSK+ENAGGE+LK+QK KV++IQSD+DK+STEINRHK
Sbjct: 817 TEEKEIDRLIQGSKKLKEKALELQSKIENAGGERLKSQKAKVNRIQSDMDKNSTEINRHK 876
Query: 890 VQIETAQKMIKKLTKGIAESKKEKEQLVEERVKMERIFDEILEKAHNVQEHYTNTQKLID 949
VQIET KMIKKLTKGI +S+KEKE+L EER K+ IF EI EKA VQE+Y TQ+LID
Sbjct: 877 VQIETGHKMIKKLTKGIEDSRKEKERLTEEREKLRGIFKEIEEKAFAVQENYKKTQELID 936
Query: 950 QHRDVLDKAKNDYEKLKKTVDELRASEIEADYKLQDLKRSYKELEMRGKGYKKRLDDLQI 1009
QH++VLDKAK++YEK+KK VDELRASE++ADY+LQD+K+SYKELE++GKGYKK+LDDLQ
Sbjct: 937 QHKEVLDKAKSEYEKVKKIVDELRASEVDADYRLQDMKKSYKELELKGKGYKKKLDDLQN 996
Query: 1010 TLLKHLEQIQKDLVDPEKLQATLADQTLSDACDLKRTLEMVALLEAQLKELNPNLDSITE 1069
LL H+EQ QK+L DPEKLQATLAD+TL++ACDLKR LE V LLEAQLK++NPNLDSI+E
Sbjct: 997 ALLHHMEQTQKELEDPEKLQATLADKTLAEACDLKRALERVVLLEAQLKDMNPNLDSISE 1056
Query: 1070 YRRKVAAYNERVEDLTTVTQQRDDVKKQYDEWRKKR------LDEFMAGFNAISLKLKEM 1123
YRRKV++YNERVE+L VTQQRDD+K+QYDEWRKKR LDEFMAGFN ISLKLKEM
Sbjct: 1057 YRRKVSSYNERVEELNLVTQQRDDIKRQYDEWRKKRLVFSFLLDEFMAGFNTISLKLKEM 1116
Query: 1124 YQMITLGGDAELELVDSLDPFSEGVVFSVRPPKKSWKNIANLSGGEKTLSSLALVFALHH 1183
YQMITLGGDAELELVDSLDPFSEGVVFSVRPPKKSWKNIANLSGGEKTLSSLALVFALHH
Sbjct: 1117 YQMITLGGDAELELVDSLDPFSEGVVFSVRPPKKSWKNIANLSGGEKTLSSLALVFALHH 1176
Query: 1184 YKPTPLYVMDEIDAALDFKNVSIVGHYVKDRTKDAQFIIISLRNNMFELADRLVGIYKTD 1243
YKPTPLYVMDEIDAALDFKNVSIVGHYVKDRTKDAQFIIISLRNNMFELADRLVGIYKTD
Sbjct: 1177 YKPTPLYVMDEIDAALDFKNVSIVGHYVKDRTKDAQFIIISLRNNMFELADRLVGIYKTD 1236
Query: 1244 NCTKSITINPGSFTVCENAA 1263
NCTKSITINPGSF VC+NAA
Sbjct: 1237 NCTKSITINPGSFVVCQNAA 1256
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296082911|emb|CBI22212.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359489002|ref|XP_003633856.1| PREDICTED: structural maintenance of chromosomes protein 4-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255587856|ref|XP_002534418.1| Structural maintenance of chromosome, putative [Ricinus communis] gi|223525329|gb|EEF27966.1| Structural maintenance of chromosome, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356573489|ref|XP_003554891.1| PREDICTED: structural maintenance of chromosomes protein 4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356550968|ref|XP_003543852.1| PREDICTED: structural maintenance of chromosomes protein 4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357517581|ref|XP_003629079.1| Structural maintenance of chromosomes protein [Medicago truncatula] gi|355523101|gb|AET03555.1| Structural maintenance of chromosomes protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|334188261|ref|NP_001190492.1| structural maintenance of chromosomes protein 4 [Arabidopsis thaliana] gi|332008312|gb|AED95695.1| structural maintenance of chromosomes protein 4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15239023|ref|NP_199671.1| structural maintenance of chromosomes protein 4 [Arabidopsis thaliana] gi|75333958|sp|Q9FJL0.1|SMC4_ARATH RecName: Full=Structural maintenance of chromosomes protein 4; Short=AtSMC4; Short=SMC protein 4; Short=SMC-4; AltName: Full=Chromosome-associated protein C; Short=AtCAP-C gi|10177350|dbj|BAB10693.1| chromosome condensation protein [Arabidopsis thaliana] gi|332008311|gb|AED95694.1| structural maintenance of chromosomes protein 4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|46981263|gb|AAT07581.1| putative SMC protein [Oryza sativa Japonica Group] gi|218197032|gb|EEC79459.1| hypothetical protein OsI_20467 [Oryza sativa Indica Group] gi|222632094|gb|EEE64226.1| hypothetical protein OsJ_19059 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1263 | ||||||
| DICTYBASE|DDB_G0286403 | 1415 | smc4 "structural maintenance o | 0.950 | 0.848 | 0.364 | 1.4e-192 | |
| CGD|CAL0003745 | 1368 | SMC4 [Candida albicans (taxid: | 0.946 | 0.874 | 0.327 | 2.5e-161 | |
| UNIPROTKB|E9PD53 | 1263 | SMC4 "Structural maintenance o | 0.768 | 0.768 | 0.362 | 1.6e-148 | |
| UNIPROTKB|Q9NTJ3 | 1288 | SMC4 "Structural maintenance o | 0.768 | 0.753 | 0.362 | 1.6e-148 | |
| UNIPROTKB|E2RCX4 | 1288 | SMC4 "Structural maintenance o | 0.770 | 0.755 | 0.358 | 2.7e-148 | |
| UNIPROTKB|P50532 | 1290 | smc4 "Structural maintenance o | 0.803 | 0.786 | 0.338 | 9e-148 | |
| UNIPROTKB|F1SH51 | 1288 | SMC4 "Structural maintenance o | 0.766 | 0.751 | 0.359 | 8.1e-147 | |
| UNIPROTKB|F1NDN4 | 1274 | SMC4 "Structural maintenance o | 0.806 | 0.799 | 0.354 | 2.2e-146 | |
| UNIPROTKB|F1P3C6 | 1300 | SMC4 "Structural maintenance o | 0.806 | 0.783 | 0.354 | 2.2e-146 | |
| UNIPROTKB|Q9ERA5 | 1243 | SMC4 "Structural maintenance o | 0.726 | 0.737 | 0.368 | 4.5e-146 |
| DICTYBASE|DDB_G0286403 smc4 "structural maintenance of chromosome protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Score = 1866 (661.9 bits), Expect = 1.4e-192, P = 1.4e-192
Identities = 467/1282 (36%), Positives = 711/1282 (55%)
Query: 9 SASPGSRKWPRLFIKEMVMRNFKSYAGEQRVGPFHKSFSAVVGPNGSGKSNVIDAMLFVF 68
S++ G K RL I +MVM NFKSYAG Q VGPFHK FS+VVGPNGSGKSNVIDAMLFVF
Sbjct: 149 SSNNGIEK--RLMITKMVMENFKSYAGAQEVGPFHKCFSSVVGPNGSGKSNVIDAMLFVF 206
Query: 69 GKRAKQMRLNKVSELIHNSTNYQNLDSAGVSVHFQEIVDLD-DGTYEAIQGSDFVISRVA 127
G RAKQ+RLNK+SELIHNS N++NL + VSVHFQEI+DL + YE ++GS+FV++R A
Sbjct: 207 GYRAKQIRLNKISELIHNSENHKNLTNGRVSVHFQEIIDLPGEDNYEVVKGSEFVVTRTA 266
Query: 128 FRDNSSKYYINDRPSNFTEVTKKLKGKGVDLDNNRFLILQGEVEQISLMKPKGQGPHDEG 187
+ ++K D S + L K V LD+ + +++K KG +
Sbjct: 267 QKTGNNK----DGVSKYY-----LNDKVVKLDDLK-----------TILKDKGIDLDNNR 306
Query: 188 FLEY---LEDI-IGTDRYVEKIDESYKDYVVLFDLIGLNHSMRNVPVLFKWLN--WQRKK 241
FL +E I + + V +E +Y L D+IG + ++ K + ++
Sbjct: 307 FLILQGEVEQIAMMKPKGVHPGEEGLLEY--LEDIIGSKKYLPDIEATSKLIEDIGDKRT 364
Query: 242 EIAWRFVCV-----SVLDVKNEAEAYMLKELSLLKWQEKATNLAYEDTSLKIVELQENVS 296
R V ++ ++ A Y+ KEL L+ + + + E+
Sbjct: 365 SSNNRMKVVEKEKDALQQERDNALEYIDKELKLIHCKSIHYQIGRSKPEREKNEIAAKQE 424
Query: 297 XXXXXXXXXXXXIQDNNKTLKELESVHNKYMRRQEELDNDLRVSKEEFKEFERQDVKYRE 356
+ +N L E E + ++ +EL+ + K E E++ VKY+E
Sbjct: 425 MVEKQLEQELVTQKASNDKLLEFEKNLKQQNKQLDELNKQMAKCKNELLTTEKKGVKYKE 484
Query: 357 DSKHMKQKIKKLEVKVEKDSSKIDDLTKECEHATNQIPKLEENIPKLLKLFENVFIADTQ 416
++KH+K K+KK +E+++ K + + I + E+ +L K I + +
Sbjct: 485 ETKHLKTKVKKNNSVIEEETKKQAEFERSTIIHKQDIVRFEKEYVELPK----ELIVEEK 540
Query: 417 NIITFPFMNMIN-LCVETERYRSELATVRAELEPWEKELIVHKGKLEVTCTESKLLCEKH 475
+ +M+N L E + E+ + +L PW K+ K +++ +E +L +
Sbjct: 541 KL-----ESMLNSLKGEVTELQREMEEKQKQLLPWSKKHSEAKAVVDLKTSELAVLSKDF 595
Query: 476 EAGRKAFEDAQRQMDDILRRIDTKTTAIRNMQGDLEKNKLEAMEAHNVEQECFKEQETLI 535
+ +DA + ++D T+ I + +LE K ++ +E L
Sbjct: 596 NGATQNLDDAIKALEDAKTISSTRKNNITKSKKELESVKAIIVDLEKRLASGKVTEENLY 655
Query: 536 PLEQAARQKVAELKSVMDSEKSQGSVLKAILQAKESNQIEGIYGRMGDLGAIDAKYDIAV 595
A++++ ++K+ + S+ ++L +L+ KES QI GI+GR+GDLGAID KYD+A+
Sbjct: 656 RNTMDAKRQLEQIKTNLSENSSRNTILDRLLKIKESGQISGIHGRLGDLGAIDQKYDVAI 715
Query: 596 STAC-PGLDYIVVETTSAAQACVELLRREKLGVATFMILEKQVDLFPKMKEHFSTPENVP 654
STA +D I+VETT+AA+ACVELLR+E LG ATFMILE ++ + TP N P
Sbjct: 716 STAAFSQMDNIIVETTAAAEACVELLRKENLGRATFMILEN-LEYQRQNLGPVQTPNNTP 774
Query: 655 RLFDLIKVKDERM-KLAFYAAMGNTLVAKDLDQATRIAYSGNKEFRRVVTLDGALFEKSX 713
RLFDLIK+KDE+ AF+ A+G+TLVA LD+AT+IAY + RVVTLDG+L + S
Sbjct: 775 RLFDLIKMKDEKKYATAFFTAVGHTLVADTLDEATKIAYGAKRH--RVVTLDGSLIDTSG 832
Query: 714 XXXXXXXXXXXXXXXXSIR-PTSVSAEAIINAEKELSAMVDNLSRIRQKIADAVKHYQAS 772
++ + +I + LS + +L + R ++ + Q +
Sbjct: 833 AMSGGGLKPRVGAMNSKLKGDPKEDKKKLIELQDNLSQLDSDLRQCRDELVEIENQIQQA 892
Query: 773 EKAVAHLEMELAKSRKEIESLKSQHSYLEKQLDSLK---AASEPRKDEIDRLEELQXXXX 829
+ + LE+EL K +I++ ++ L K + LK S +K++ID ++E
Sbjct: 893 QNRRSELELELPKMDMDIKAAITKCEELTKVIPQLKNKAKLSTEKKEQIDSIKESLIVDQ 952
Query: 830 XXXXXXXXXVNGSKDLKEKALQLQSKVENAGGEKLKAQKLKVDKIQSDIDKSSTEINRHK 889
VN L+ + ++Q+ + N GG +LK QK KV+ +QS ID + T +
Sbjct: 953 KSLDKVQEKVN---KLESEVQEIQNSILNVGGPQLKMQKNKVESLQSRIDSNQTNTTKAN 1009
Query: 890 VQIETAQKMIKKLTKGIAESKKEKEQ--------------LVEERVKMERIFDEILEKAH 935
VQI++ K ++K K + E+ KEK++ L +E +K + + E+
Sbjct: 1010 VQIKSLAKSMEKSIKILNENTKEKDENEAALAEILEKYKSLEKENLKATEAMEAVSEQLR 1069
Query: 936 NVQEHYTNTQKLIDQHRDVLDKAKNDYEKLKKTVDELRASEIEADYKLQDLKRSYKELEM 995
+E +K ++ + V++K K KL+ ++E + E ++ D +
Sbjct: 1070 EKEEETKEIRKEHEKAKKVIEKIKVSNSKLETQIEEFKTLINEKQAEIADCLSKFANQAK 1129
Query: 996 RGKGYKKRLDDLQITLLKHLEQIQKDLVDPEKLQATLADQTLSDACDLKRTLEMVALLEA 1055
+ K YK +D+ +L+ + I + PE+++ + + + + E+ ++
Sbjct: 1130 KAKIYKDYVDE---SLINQVSAI----LTPEEIEQYMEATEQQNL--IAKIHELTTQIQK 1180
Query: 1056 QLKELNPNLDSITEYRRKVAAYNERVEDLTTVTQQRDDVKKQYDEWRKKRLDEFMAGFNA 1115
KE N N++ + ++++K Y+ R + + ++RD++ K+Y+ RK RLDEFMAGF
Sbjct: 1181 ISKENNVNIEVVKDFQKKEQEYHSRKAEFDEIEKERDNLSKRYESLRKNRLDEFMAGFTI 1240
Query: 1116 ISLKLKEMYQMITLGGDAELELVDSLDPFSEGVVFSVRPPKKSWKNIANLSGGEKTLSSL 1175
I++KLKE+YQMITLGGDAELE++D DPF EG+ FSVRPPKKSWKNI+NLSGGEKTLSSL
Sbjct: 1241 ITMKLKEIYQMITLGGDAELEIIDREDPFQEGISFSVRPPKKSWKNISNLSGGEKTLSSL 1300
Query: 1176 ALVFALHHYKPTPLYVMDEIDAALDFKNVSIVGHYVKDRTKDAQFIIISLRNNMFELADR 1235
ALVFALHHYKP LYVMDEIDAALDFKNVSI+ +Y+K+RTK+AQFIIISLRN MFELADR
Sbjct: 1301 ALVFALHHYKPNALYVMDEIDAALDFKNVSIIANYIKERTKNAQFIIISLRNYMFELADR 1360
Query: 1236 LVGIYKTDNCTKSITINPGSFT 1257
LVGIYKTDNCTKS+TINP SFT
Sbjct: 1361 LVGIYKTDNCTKSVTINPNSFT 1382
|
|
| CGD|CAL0003745 SMC4 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PD53 SMC4 "Structural maintenance of chromosomes protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NTJ3 SMC4 "Structural maintenance of chromosomes protein 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RCX4 SMC4 "Structural maintenance of chromosomes protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P50532 smc4 "Structural maintenance of chromosomes protein 4" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SH51 SMC4 "Structural maintenance of chromosomes protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NDN4 SMC4 "Structural maintenance of chromosomes protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P3C6 SMC4 "Structural maintenance of chromosomes protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9ERA5 SMC4 "Structural maintenance of chromosomes protein 4" [Microtus arvalis (taxid:47230)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1263 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-164 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-128 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-112 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-102 | |
| cd03274 | 212 | cd03274, ABC_SMC4_euk, ATP-binding cassette domain | 1e-68 | |
| cd03274 | 212 | cd03274, ABC_SMC4_euk, ATP-binding cassette domain | 3e-62 | |
| cd03239 | 178 | cd03239, ABC_SMC_head, The SMC head domain belongs | 4e-32 | |
| cd03275 | 247 | cd03275, ABC_SMC1_euk, ATP-binding cassette domain | 4e-31 | |
| cd03275 | 247 | cd03275, ABC_SMC1_euk, ATP-binding cassette domain | 4e-31 | |
| smart00968 | 120 | smart00968, SMC_hinge, SMC proteins Flexible Hinge | 6e-30 | |
| cd03278 | 197 | cd03278, ABC_SMC_barmotin, ATP-binding cassette do | 2e-28 | |
| pfam06470 | 117 | pfam06470, SMC_hinge, SMC proteins Flexible Hinge | 4e-27 | |
| cd03278 | 197 | cd03278, ABC_SMC_barmotin, ATP-binding cassette do | 7e-23 | |
| cd03227 | 162 | cd03227, ABC_Class2, ATP-binding cassette domain o | 8e-23 | |
| cd03239 | 178 | cd03239, ABC_SMC_head, The SMC head domain belongs | 2e-21 | |
| cd03273 | 251 | cd03273, ABC_SMC2_euk, ATP-binding cassette domain | 2e-20 | |
| cd03273 | 251 | cd03273, ABC_SMC2_euk, ATP-binding cassette domain | 5e-19 | |
| cd03272 | 243 | cd03272, ABC_SMC3_euk, ATP-binding cassette domain | 1e-15 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 8e-13 | |
| cd03227 | 162 | cd03227, ABC_Class2, ATP-binding cassette domain o | 2e-12 | |
| cd03272 | 243 | cd03272, ABC_SMC3_euk, ATP-binding cassette domain | 3e-10 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-10 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-10 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-09 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-08 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 7e-08 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 7e-08 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-07 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 3e-07 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 3e-07 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 7e-07 | |
| cd03241 | 276 | cd03241, ABC_RecN, ATP-binding cassette domain of | 1e-06 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 2e-06 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 2e-06 | |
| PHA02562 | 562 | PHA02562, 46, endonuclease subunit; Provisional | 5e-06 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 6e-06 | |
| PRK04778 | 569 | PRK04778, PRK04778, septation ring formation regul | 7e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-05 | |
| pfam06160 | 559 | pfam06160, EzrA, Septation ring formation regulato | 1e-05 | |
| cd03240 | 204 | cd03240, ABC_Rad50, ATP-binding cassette domain of | 2e-05 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 2e-05 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 3e-05 | |
| pfam13555 | 60 | pfam13555, AAA_29, P-loop containing region of AAA | 3e-05 | |
| pfam10174 | 774 | pfam10174, Cast, RIM-binding protein of the cytoma | 3e-05 | |
| TIGR00606 | 1311 | TIGR00606, rad50, rad50 | 4e-05 | |
| COG0497 | 557 | COG0497, RecN, ATPase involved in DNA repair [DNA | 5e-05 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 6e-05 | |
| cd03276 | 198 | cd03276, ABC_SMC6_euk, ATP-binding cassette domain | 6e-05 | |
| TIGR03185 | 650 | TIGR03185, DNA_S_dndD, DNA sulfur modification pro | 7e-05 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 9e-05 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 9e-05 | |
| TIGR00634 | 563 | TIGR00634, recN, DNA repair protein RecN | 9e-05 | |
| pfam09726 | 680 | pfam09726, Macoilin, Transmembrane protein | 9e-05 | |
| pfam13304 | 256 | pfam13304, AAA_21, AAA domain | 1e-04 | |
| pfam05667 | 536 | pfam05667, DUF812, Protein of unknown function (DU | 2e-04 | |
| COG5022 | 1463 | COG5022, COG5022, Myosin heavy chain [Cytoskeleton | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 5e-04 | |
| cd03277 | 213 | cd03277, ABC_SMC5_euk, ATP-binding cassette domain | 6e-04 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 8e-04 | |
| PLN02939 | 977 | PLN02939, PLN02939, transferase, transferring glyc | 8e-04 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 8e-04 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 0.001 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 0.001 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 0.001 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 0.001 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.001 | |
| pfam11887 | 270 | pfam11887, DUF3407, Protein of unknown function (D | 0.001 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.002 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 0.002 | |
| COG5185 | 622 | COG5185, HEC1, Protein involved in chromosome segr | 0.002 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.002 | |
| cd03279 | 213 | cd03279, ABC_sbcCD, ATP-binding cassette domain of | 0.002 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 0.002 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.003 | |
| COG5185 | 622 | COG5185, HEC1, Protein involved in chromosome segr | 0.003 | |
| cd03225 | 211 | cd03225, ABC_cobalt_CbiO_domain1, First domain of | 0.003 | |
| COG1340 | 294 | COG1340, COG1340, Uncharacterized archaeal coiled- | 0.003 | |
| cd03242 | 270 | cd03242, ABC_RecF, ATP-binding cassette domain of | 0.003 | |
| pfam00521 | 427 | pfam00521, DNA_topoisoIV, DNA gyrase/topoisomerase | 0.003 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.004 | |
| cd03277 | 213 | cd03277, ABC_SMC5_euk, ATP-binding cassette domain | 0.004 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 520 bits (1341), Expect = e-164
Identities = 317/1251 (25%), Positives = 626/1251 (50%), Gaps = 114/1251 (9%)
Query: 20 LFIKEMVMRNFKSYAGEQRVGPFHKSFSAVVGPNGSGKSNVIDAMLFVFG-KRAKQMRLN 78
+++K + ++ FKS+A F F+A+VGPNGSGKSN++DA+ FV G + AK +R +
Sbjct: 1 MYLKRIELKGFKSFADPT-EINFSPGFTAIVGPNGSGKSNIVDAIRFVLGEQSAKNLRAS 59
Query: 79 KVSELIHNSTNYQN-LDSAGVSVHFQEIVDLDDGTYEAIQGSDFVISRVAFRDNSSKYYI 137
K+S+LI + + + A V + F D D T ++ + ++R +RD S+YYI
Sbjct: 60 KMSDLIFAGSGNRKPANYAEVELTF----DNSDNTLP-LEYEEISVTRRIYRDGESEYYI 114
Query: 138 NDRPSNFTEVTKKLKGKGVDLDNNRFLILQGEVEQISLMKPKGQGPHDEGFLEYLEDIIG 197
N ++ L G+ ++ ++ QG+VE+I KP E + +E+ G
Sbjct: 115 NGEKVRLKDIQDLLADSGIGKES-YSIVSQGKVEEIINAKP-------EERRKLIEEAAG 166
Query: 198 TDRYVEKIDESYK--DYVV-----LFDLIGLNHSMRNVPVLFKWLNWQRKKEIAWRFVCV 250
+Y E+ +E+ + + L DL L + + L +R+ E A R+
Sbjct: 167 VSKYKERKEEAERKLERTEENLERLEDL--LEELEKQLEKL------ERQAEKAERY--- 215
Query: 251 SVLDVKNEAEAYMLKELSLLKWQEKATNLAYEDTSLKIVELQENVSKLEENLKNEREKIQ 310
++K E EL+LL + ++ ++ EL+E +S+LEE L+ +E+++
Sbjct: 216 --QELKAELREL---ELALLLAK-------LKELRKELEELEEELSRLEEELEELQEELE 263
Query: 311 DNNKTLKELESVHNKYMRRQEELDNDLRVSKEEFKEFERQDVKYREDSKHMKQKIKKLEV 370
+ K ++EL+S + EEL +L KEE +E E + RE + ++ ++++LE
Sbjct: 264 EAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRERLEELENELEELEE 323
Query: 371 KVEKDSSKIDDLTKECEHATNQIPKLEENIPKLLKLFE------NVFIADTQNIITFPFM 424
++E+ KI+ L +E E + +LE+ + +L + E + + + + +
Sbjct: 324 RLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEELF----- 378
Query: 425 NMINLCVETERYRSELATVRAELEPWEKELIVHKGKLEVTCTESKLLCEKHEAGRKAFED 484
E R ELA + AEL EL K ++E + L E+ E ++ ++
Sbjct: 379 ---------EALREELAELEAELAEIRNELEELKREIESLEERLERLSERLEDLKEELKE 429
Query: 485 AQRQMDDILRRIDTKTTAIRNMQGDLEKNKLEAMEAHNVEQECFKEQETLIPLEQAARQK 544
+ +++++ ++ + ++ LE+ + +E+E + QE L LE+
Sbjct: 430 LEAELEELQTELEELNEELEELEEQLEELR---DRLKELERELAELQEELQRLEKELSSL 486
Query: 545 VAELKSVMDSEKSQGSVLKAILQAKESNQIEGIYGRMGDLGAIDAKYDIAVSTACPG-LD 603
A L +++E+ ++A+L+A ES + G+YG + +L + KY+ A+ A L
Sbjct: 487 EARLDR-LEAEQRASQGVRAVLEALESG-LPGVYGPVAELIKVKEKYETALEAALGNRLQ 544
Query: 604 YIVVETTSAAQACVELLRREKLGVATFMILEKQVDLFPKMKEHFSTPENVPRLFDLIKVK 663
+VVE A+ +E L+ K G ATF+ L++ L + P + DLI
Sbjct: 545 AVVVENEEVAKKAIEFLKENKAGRATFLPLDRIKPLRSLKSDA--APGFLGLASDLID-F 601
Query: 664 DERMKLAFYAAMGNTLVAKDLDQATRIAYSGNKEFRRVVTLDGALFEKSGTMSGGGSKPR 723
D + + A +G+TLV DL+QA R+A + R+VTLDG L E SG+++GG R
Sbjct: 602 DPKYEPAVRFVLGDTLVVDDLEQARRLAR-KLRIKYRIVTLDGDLVEPSGSITGGSRNKR 660
Query: 724 GGKMGTSIRPTSVSAEAIINAEKELSAMVDNLSRIRQKIADAVKHYQASEKAVAHLEMEL 783
+ ++EL + + L+ + ++ + ++ + + LE L
Sbjct: 661 SS----------------LAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLL 704
Query: 784 AKSRKEIESLKSQHSYLEKQLDSLKAASEPRKDEIDRLEELQKIISAEEKEIEKIVNGSK 843
+ R+++E L+ Q L+++L +L+ E + ++ LEE + + E +E+++ +
Sbjct: 705 EELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLE--- 761
Query: 844 DLKEKALQLQSKVENAGGEKLKAQKLKVDKIQSDIDKSSTEINRHKVQIETAQKMIKKLT 903
+L+E+ L+ + E+++ + K +Q ++++ E+ + +++ ++ ++ L
Sbjct: 762 ELEEELESLEEALAK-LKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLE 820
Query: 904 KGIAESKKEKEQLVEERVKMERIFDEILEKAHNVQEHYTNTQKLIDQHRDVLDKAKNDYE 963
+ ++E E+L EE ++E DE+ E+ +++ ++ +++ ++ +++ +
Sbjct: 821 QRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELK 880
Query: 964 KLKKTVDELRASEIEADYKLQDLKRSYKELEMRGKGYKKRLDDLQITLLKHLEQIQKDLV 1023
+L++ +EL E + +L +LK ++L R + + +L+ L++ L + E+++++
Sbjct: 881 ELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEELEEEYE 940
Query: 1024 DPEKLQATLADQTLSDACDLKRTLEMVALLEAQLKELNP-NLDSITEYRRKVAAYNERVE 1082
D + + + LE +++ L P NL +I EY Y E
Sbjct: 941 DTLETELE----------------REIERLEEEIEALGPVNLRAIEEYEEVEERYEELKS 984
Query: 1083 DLTTVTQQRDDVKKQYDEWRKKRLDEFMAGFNAISLKLKEMYQMITLGGDAELELVDSLD 1142
+ + ++ + + +E K++ + F F+ I+ E+++ + GG AELEL + D
Sbjct: 985 QREDLEEAKEKLLEVIEELDKEKRERFKETFDKINENFSEIFKELFGGGTAELELTEPDD 1044
Query: 1143 PFSEGVVFSVRPPKKSWKNIANLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFK 1202
P + G+ S RPP K ++++ LSGGEK+L++LAL+FA+ Y+P P YV+DE+DAALD
Sbjct: 1045 PLTAGIEISARPPGKKLQSLSLLSGGEKSLTALALLFAIQKYRPAPFYVLDEVDAALDDA 1104
Query: 1203 NVSIVGHYVKDRTKDAQFIIISLRNNMFELADRLVGIYK-TDNCTKSITIN 1252
NV V +K+ +K+ QFI+I+ R E ADRLVG+ +K ++++
Sbjct: 1105 NVERVARLIKEMSKETQFIVITHRKGTMEAADRLVGVTMQEKGVSKVVSVD 1155
|
Length = 1163 |
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|213241 cd03274, ABC_SMC4_euk, ATP-binding cassette domain of eukaryotic SMC4 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213241 cd03274, ABC_SMC4_euk, ATP-binding cassette domain of eukaryotic SMC4 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213206 cd03239, ABC_SMC_head, The SMC head domain belongs to the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|213242 cd03275, ABC_SMC1_euk, ATP-binding cassette domain of eukaryotic SMC1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213242 cd03275, ABC_SMC1_euk, ATP-binding cassette domain of eukaryotic SMC1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214944 smart00968, SMC_hinge, SMC proteins Flexible Hinge Domain | Back alignment and domain information |
|---|
| >gnl|CDD|213245 cd03278, ABC_SMC_barmotin, ATP-binding cassette domain of barmotin, a member of the SMC protein family | Back alignment and domain information |
|---|
| >gnl|CDD|219044 pfam06470, SMC_hinge, SMC proteins Flexible Hinge Domain | Back alignment and domain information |
|---|
| >gnl|CDD|213245 cd03278, ABC_SMC_barmotin, ATP-binding cassette domain of barmotin, a member of the SMC protein family | Back alignment and domain information |
|---|
| >gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213206 cd03239, ABC_SMC_head, The SMC head domain belongs to the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|213240 cd03273, ABC_SMC2_euk, ATP-binding cassette domain of eukaryotic SMC2 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213240 cd03273, ABC_SMC2_euk, ATP-binding cassette domain of eukaryotic SMC2 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213239 cd03272, ABC_SMC3_euk, ATP-binding cassette domain of eukaryotic SMC3 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213239 cd03272, ABC_SMC3_euk, ATP-binding cassette domain of eukaryotic SMC3 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213208 cd03241, ABC_RecN, ATP-binding cassette domain of RecN | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222878 PHA02562, 46, endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179877 PRK04778, PRK04778, septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|114855 pfam06160, EzrA, Septation ring formation regulator, EzrA | Back alignment and domain information |
|---|
| >gnl|CDD|213207 cd03240, ABC_Rad50, ATP-binding cassette domain of Rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|205733 pfam13555, AAA_29, P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone | Back alignment and domain information |
|---|
| >gnl|CDD|129694 TIGR00606, rad50, rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|223571 COG0497, RecN, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|213243 cd03276, ABC_SMC6_euk, ATP-binding cassette domain of eukaryotic SM6 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|233065 TIGR00634, recN, DNA repair protein RecN | Back alignment and domain information |
|---|
| >gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|222036 pfam13304, AAA_21, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|218681 pfam05667, DUF812, Protein of unknown function (DUF812) | Back alignment and domain information |
|---|
| >gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|213244 cd03277, ABC_SMC5_euk, ATP-binding cassette domain of eukaryotic SMC5 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|215507 PLN02939, PLN02939, transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|221291 pfam11887, DUF3407, Protein of unknown function (DUF3407) | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|227512 COG5185, HEC1, Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213246 cd03279, ABC_sbcCD, ATP-binding cassette domain of sbcCD | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|227512 COG5185, HEC1, Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|213209 cd03242, ABC_RecF, ATP-binding cassette domain of RecF | Back alignment and domain information |
|---|
| >gnl|CDD|215969 pfam00521, DNA_topoisoIV, DNA gyrase/topoisomerase IV, subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213244 cd03277, ABC_SMC5_euk, ATP-binding cassette domain of eukaryotic SMC5 proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1263 | |||
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 100.0 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 100.0 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 100.0 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 100.0 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 100.0 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 100.0 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 100.0 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 100.0 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 100.0 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 100.0 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 100.0 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 100.0 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 100.0 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 100.0 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 100.0 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 100.0 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 100.0 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 100.0 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 100.0 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 100.0 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 99.97 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.96 | |
| PF02463 | 220 | SMC_N: RecF/RecN/SMC N terminal domain; InterPro: | 99.95 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 99.95 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.94 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.93 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 99.93 | |
| PF13514 | 1111 | AAA_27: AAA domain | 99.92 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 99.92 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.9 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 99.87 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 99.87 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 99.85 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 99.83 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 99.83 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 99.81 | |
| cd03241 | 276 | ABC_RecN RecN ATPase involved in DNA repair; ABC ( | 99.79 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 99.77 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 99.76 | |
| cd03242 | 270 | ABC_RecF RecF is a recombinational DNA repair ATPa | 99.76 | |
| PRK00064 | 361 | recF recombination protein F; Reviewed | 99.74 | |
| PRK14079 | 349 | recF recombination protein F; Provisional | 99.72 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 99.72 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 99.67 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 99.65 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 99.64 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 99.64 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 99.6 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 99.6 | |
| cd03277 | 213 | ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein | 99.57 | |
| PF06470 | 120 | SMC_hinge: SMC proteins Flexible Hinge Domain; Int | 99.56 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 99.54 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 99.54 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 99.53 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 99.52 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 99.52 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 99.52 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 99.52 | |
| cd03239 | 178 | ABC_SMC_head The structural maintenance of chromos | 99.51 | |
| TIGR00611 | 365 | recf recF protein. All proteins in this family for | 99.51 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 99.51 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 99.5 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 99.5 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 99.5 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 99.49 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 99.48 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 99.46 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 99.46 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 99.45 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 99.44 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 99.44 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 99.43 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 99.42 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 99.41 | |
| cd03239 | 178 | ABC_SMC_head The structural maintenance of chromos | 99.39 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 99.39 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.39 | |
| COG1195 | 363 | RecF Recombinational DNA repair ATPase (RecF pathw | 99.38 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.38 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 99.36 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 99.36 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 99.36 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 99.35 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 99.35 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 99.35 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.35 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 99.35 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 99.35 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 99.34 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 99.34 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 99.34 | |
| cd03276 | 198 | ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein | 99.34 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 99.34 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 99.34 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 99.33 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 99.33 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 99.33 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 99.32 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 99.32 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 99.32 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 99.32 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 99.32 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 99.32 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 99.32 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 99.32 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 99.31 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 99.31 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 99.31 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 99.3 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 99.3 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 99.3 | |
| cd03241 | 276 | ABC_RecN RecN ATPase involved in DNA repair; ABC ( | 99.3 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 99.3 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 99.3 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 99.3 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.3 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 99.3 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 99.3 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.3 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 99.3 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 99.3 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 99.29 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 99.29 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 99.29 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 99.29 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.29 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 99.29 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 99.29 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 99.29 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 99.29 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 99.29 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 99.29 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 99.29 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 99.29 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.29 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 99.29 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 99.29 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 99.29 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 99.29 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 99.29 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 99.29 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 99.29 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 99.28 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 99.28 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.28 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 99.28 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 99.28 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 99.28 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 99.28 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 99.28 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 99.28 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 99.28 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 99.28 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.28 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 99.28 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 99.28 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 99.28 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 99.28 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 99.28 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 99.28 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 99.28 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 99.28 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 99.28 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.28 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 99.27 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 99.27 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 99.27 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 99.27 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.27 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 99.27 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 99.27 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 99.27 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.27 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 99.27 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 99.27 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 99.27 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 99.27 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.27 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 99.27 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.27 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 99.27 | |
| TIGR01187 | 325 | potA spermidine/putrescine ABC transporter ATP-bin | 99.27 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.27 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 99.27 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 99.27 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 99.27 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 99.26 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 99.26 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 99.26 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 99.26 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.26 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 99.26 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.26 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 99.26 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.26 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 99.26 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 99.25 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 99.25 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 99.25 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 99.25 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 99.25 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 99.25 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 99.25 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 99.25 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 99.25 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 99.25 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 99.25 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.25 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 99.25 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 99.25 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 99.25 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 99.25 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 99.25 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 99.25 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 99.25 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.25 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.25 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 99.25 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.25 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 99.24 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 99.24 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 99.24 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 99.24 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.24 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 99.24 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.24 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.24 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.24 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 99.24 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 99.24 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.24 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 99.24 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 99.24 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 99.24 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 99.24 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 99.24 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 99.24 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.24 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 99.24 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 99.24 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.24 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 99.24 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.24 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 99.24 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 99.23 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.23 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 99.23 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.23 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 99.23 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 99.23 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 99.23 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 99.23 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 99.23 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 99.23 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 99.23 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.23 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 99.23 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 99.23 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 99.23 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.23 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 99.23 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 99.23 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 99.23 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 99.23 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 99.23 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 99.22 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 99.22 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 99.22 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.22 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.22 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 99.22 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.22 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 99.22 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 99.22 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.22 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.22 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 99.22 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 99.22 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 99.22 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 99.22 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 99.21 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.21 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 99.21 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 99.21 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 99.21 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 99.21 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 99.21 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 99.21 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 99.21 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 99.21 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 99.2 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 99.2 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 99.2 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.2 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 99.2 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 99.2 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 99.2 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 99.2 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 99.2 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 99.2 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.19 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 99.19 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.19 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 99.19 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 99.19 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.19 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 99.18 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.18 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 99.18 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 99.18 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.18 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 99.18 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 99.17 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.17 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 99.17 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.17 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 99.17 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 99.17 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.17 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.17 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.17 | |
| cd03271 | 261 | ABC_UvrA_II The excision repair protein UvrA domai | 99.17 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.16 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.16 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.16 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.16 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 99.16 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 99.16 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.16 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 99.16 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.16 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 99.16 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 99.16 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 99.16 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 99.16 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 99.15 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.15 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.15 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.15 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.15 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.15 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 99.15 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 99.15 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.15 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 99.15 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 99.15 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.15 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.14 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 99.14 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 99.14 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 99.14 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.14 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 99.13 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.13 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 99.13 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 99.13 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 99.11 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 99.11 | |
| cd03277 | 213 | ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein | 99.11 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 99.11 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 99.1 | |
| cd03276 | 198 | ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein | 99.1 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 99.1 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 99.1 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.1 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.09 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 99.09 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.09 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 99.09 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 99.09 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 99.09 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 99.09 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 99.08 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 99.08 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 99.08 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 99.07 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 99.07 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 99.07 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 99.07 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 99.07 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.06 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 99.05 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 99.05 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 99.05 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 99.05 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 99.05 | |
| COG4148 | 352 | ModC ABC-type molybdate transport system, ATPase c | 99.05 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 99.05 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 99.04 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.04 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.04 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.04 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 99.04 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.04 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 99.03 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 99.03 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.03 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.03 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.03 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.02 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 99.01 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 99.01 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 99.0 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 98.99 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 98.99 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 98.98 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 98.98 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 98.98 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 98.97 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 98.97 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 98.96 | |
| PF13166 | 712 | AAA_13: AAA domain | 98.95 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 98.95 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 98.95 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 98.95 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 98.94 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 98.92 | |
| PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 98.91 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 98.9 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 98.88 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 98.87 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.86 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 98.86 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 98.86 | |
| PRK00064 | 361 | recF recombination protein F; Reviewed | 98.85 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 98.84 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 98.83 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 98.83 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 98.82 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 98.82 | |
| COG5265 | 497 | ATM1 ABC-type transport system involved in Fe-S cl | 98.82 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 98.81 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 98.81 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 98.81 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 98.8 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 98.8 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 98.79 | |
| COG3950 | 440 | Predicted ATP-binding protein involved in virulenc | 98.77 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 98.77 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 98.77 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 98.76 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 98.76 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 98.76 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 98.76 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 98.75 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 98.75 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 98.74 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 98.73 | |
| KOG0056 | 790 | consensus Heavy metal exporter HMT1, ABC superfami | 98.73 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 98.72 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 98.71 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 98.71 | |
| TIGR00611 | 365 | recf recF protein. All proteins in this family for | 98.71 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 98.7 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 98.7 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 98.68 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 98.67 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 98.67 | |
| PF11398 | 373 | DUF2813: Protein of unknown function (DUF2813); In | 98.66 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 98.66 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.63 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.62 | |
| cd03242 | 270 | ABC_RecF RecF is a recombinational DNA repair ATPa | 98.59 | |
| KOG0061 | 613 | consensus Transporter, ABC superfamily (Breast can | 98.57 | |
| COG1106 | 371 | Predicted ATPases [General function prediction onl | 98.56 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 98.55 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 98.51 | |
| PRK14079 | 349 | recF recombination protein F; Provisional | 98.51 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 98.45 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.45 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 98.43 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 98.41 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 98.4 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.4 | |
| KOG0054 | 1381 | consensus Multidrug resistance-associated protein/ | 98.39 | |
| COG4637 | 373 | Predicted ATPase [General function prediction only | 98.37 | |
| PF13558 | 90 | SbcCD_C: Putative exonuclease SbcCD, C subunit; PD | 98.33 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 98.32 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 98.32 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.31 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.31 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 98.31 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 98.3 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 98.28 | |
| PF13175 | 415 | AAA_15: AAA ATPase domain | 98.27 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 98.27 | |
| KOG0059 | 885 | consensus Lipid exporter ABCA1 and related protein | 98.26 | |
| COG3593 | 581 | Predicted ATP-dependent endonuclease of the OLD fa | 98.26 | |
| PF13304 | 303 | AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T | 98.21 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.18 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 98.12 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 98.11 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 98.08 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 98.07 | |
| cd03285 | 222 | ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS | 98.07 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 98.06 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 98.05 | |
| COG4637 | 373 | Predicted ATPase [General function prediction only | 98.03 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.02 | |
| KOG0054 | 1381 | consensus Multidrug resistance-associated protein/ | 98.01 |
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.2e-139 Score=1199.78 Aligned_cols=1207 Identities=47% Similarity=0.706 Sum_probs=1057.1
Q ss_pred CCCCCceEEEEEEecCccccCCCcccccCCCcceEEEcCCCCChhHHHHHHHHHcCcchhhhhhhcccccccccccCCCC
Q 000833 14 SRKWPRLFIKEMVMRNFKSYAGEQRVGPFHKSFSAVVGPNGSGKSNVIDAMLFVFGKRAKQMRLNKVSELIHNSTNYQNL 93 (1263)
Q Consensus 14 ~~~~~~m~i~~l~l~nFks~~~~~~~~~~~~~~~~i~G~nGsGKS~i~~ai~~~lg~~~~~~r~~~~~~~i~~g~~~~~~ 93 (1263)
....++|+|..|.+.|||||+|.+++|||++.|++||||||||||||+|||.||||.+|+.+|.+++++|||++.++++.
T Consensus 78 ~~~~~RL~I~~i~~~NFKSYaG~~ilGPFHksFtaIvGPNGSGKSNVIDsmLFVFGfRA~kiR~~klS~LIh~S~~~~~l 157 (1293)
T KOG0996|consen 78 EAGGPRLMITEIVVENFKSYAGKQILGPFHKSFTAIVGPNGSGKSNVIDSMLFVFGFRASKIRSKKLSALIHKSDGHPNL 157 (1293)
T ss_pred CCCCCeeeehhhhhhhhhhhcCceeecCCCCCceeeECCCCCCchHHHHHHHHHhhhhHhHHhHHHHHHHHhccCCCCCC
Confidence 45678899999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CceEEEEEEeeccccCCCcccccCCceEEEEEEeecCCCceEEEcCcccCHHHHHHHHHhCCCCCCCCccccchhhHHHH
Q 000833 94 DSAGVSVHFQEIVDLDDGTYEAIQGSDFVISRVAFRDNSSKYYINDRPSNFTEVTKKLKGKGVDLDNNRFLILQGEVEQI 173 (1263)
Q Consensus 94 ~~a~v~~~~~~~~~~~~~~~~~~~~~~~~i~r~~~~~~~~~y~in~~~~~~~~~~~~~~~~~i~~~~~~~~i~qg~v~~~ 173 (1263)
.+|+|+++|+-+.|-+++.|..+++.+++|+|+.|++++|.|+|||++++.++|..+|..-||+++++.|+|.||.|++|
T Consensus 158 ~SCsV~vhFq~iiD~~~~~~E~vp~s~~~ItRtA~~~NsSkY~Ingk~as~~~V~~lLk~~gIDleHNRFLILQGEVE~I 237 (1293)
T KOG0996|consen 158 QSCSVEVHFQKIIDKPGGTYEVVPDSEFTITRTAFRDNSSKYYINGKEASFKDVTKLLKSHGIDLEHNRFLILQGEVEQI 237 (1293)
T ss_pred cceeEEEeeeeeeccCCCceeecCCCeeEEEehhhhCCCceEeECCccccHHHHHHHHHhcCCCCccceeeeehhhHHHH
Confidence 99999999998877777777888999999999999999999999999999999999999999999999999999999999
Q ss_pred HhcCCCCCCCCchhHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHH-hhhhccccchhhHhhhhhhhhhhHHHHHhHHhH
Q 000833 174 SLMKPKGQGPHDEGFLEYLEDIIGTDRYVEKIDESYKDYVVLFDLI-GLNHSMRNVPVLFKWLNWQRKKEIAWRFVCVSV 252 (1263)
Q Consensus 174 ~~~~~~~~~~~~~~~~~~le~~~g~~~~~~~~~~~~~~l~~~~~~~-~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~l 252 (1263)
++|+|...++++.+++++||+++|+.+|+..++....++..+++.+ +...+++ ..+ .+ .+.|
T Consensus 238 A~MKPk~~~e~d~GmLEYLEDIIGT~ry~~~I~~~~~rv~~L~e~~sek~~~~k---~~e--------~e------k~~l 300 (1293)
T KOG0996|consen 238 AMMKPKAQTENDEGMLEYLEDIIGTNRYKEPIEELMRRVERLNEDRSEKENRVK---LVE--------KE------KKAL 300 (1293)
T ss_pred HhcCCCCCCCCcchHHHHHHHHhcccccchhHHHHHHHHHhhhHHHHHHHHHHH---HHH--------HH------HHHH
Confidence 9999999999999999999999999999999999999999999999 8888888 666 66 8899
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHH
Q 000833 253 LDVKNEAEAYMLKELSLLKWQEKATNLAYEDTSLKIVELQENVSKLEENLKNEREKIQD-NNKTLKELESVHNKYMRRQE 331 (1263)
Q Consensus 253 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~-~~~~l~~l~~~~~~~~~~~~ 331 (1263)
+..+..+..|+...+++..++..+.+..+.....++....+.+..+...+......+.. -....+..+.....+.....
T Consensus 301 E~~k~~al~fL~kenel~~~~~~~~q~~~~~~~~ki~~~~~~~~~~~e~lk~~~ek~~~e~~~~~~k~e~~~~~~~e~~~ 380 (1293)
T KOG0996|consen 301 EGPKNEALEFLKKENELFRKKNKLCQYILYESRAKIAEMQEELEKIEEGLKDENEKFDIESNEEVEKNEAVKKEIKERAK 380 (1293)
T ss_pred hhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999988888888888888888888888888777766663 33333333333344544445
Q ss_pred HHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHhhhhhHHHHhhHHHHHhhhH--
Q 000833 332 ELDNDLRVSKEEFKEFERQDVKYREDSKHMKQKIKKLEVKVEKDSSKIDDLTKECEHATNQIPKLEENIPKLLKLFEN-- 409 (1263)
Q Consensus 332 ~l~~~l~~~~~~l~~~~~~~~~l~~~l~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~-- 409 (1263)
.+.+....++..+..++.+....++.++++...+.++..+++..+.++.+++.........+.+.+.++..+......
T Consensus 381 ~~kn~~~~~k~~~~~~e~~~vk~~E~lK~~~~k~kKleke~ek~~~~~~e~e~~pe~~~~~i~~~~~ei~~L~~~~~~~~ 460 (1293)
T KOG0996|consen 381 ELKNKFESLKKKFQDLEREDVKREEKLKRLTSKIKKLEKEIEKARRKKSELEKAPEKARIEIQKCQTEIEQLEELLEKEE 460 (1293)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHhCchhhHhHHHHHHHHHHHHHHHHHHHH
Confidence 566678888889999999999999999999999999999999999999999999999999999998888888876665
Q ss_pred HHHHhhhhccccchhhhhhhhHhHHHHHHHHHHHHHhhhHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000833 410 VFIADTQNIITFPFMNMINLCVETERYRSELATVRAELEPWEKELIVHKGKLEVTCTESKLLCEKHEAGRKAFEDAQRQM 489 (1263)
Q Consensus 410 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~l~~~~ 489 (1263)
..+.+ + +..+..+...+..++...+.++..|..++.....+++.++++++.+....+.....+..++..+
T Consensus 461 ~~l~e----~------~~~l~~~t~~~~~e~~~~ekel~~~~~~~n~~~~e~~vaesel~~L~~~~~~~~~~~e~lk~~L 530 (1293)
T KOG0996|consen 461 RELDE----I------LDSLKQETEGIREEIEKLEKELMPLLKQVNEARSELDVAESELDILLSRHETGLKKVEELKGKL 530 (1293)
T ss_pred HHHHH----H------HHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 22333 2 5566778888899999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHhHHHHHHHHHHhHHHHHHHHHHHHHHHHHhhhhhhhhhHHHHHHHHHH
Q 000833 490 DDILRRIDTKTTAIRNMQGDLEKNKLEAMEAHNVEQECFKEQETLIPLEQAARQKVAELKSVMDSEKSQGSVLKAILQAK 569 (1263)
Q Consensus 490 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~l~~~~ 569 (1263)
........+....+..+...+...+.++.+....+..+......+...+...++++.+++..+....++..++.++.+.+
T Consensus 531 ~~~~~~~~e~~~~l~~~k~~l~~~k~e~~~~~k~l~~~~~e~~~~~~~~~~~rqrveE~ks~~~~~~s~~kVl~al~r~k 610 (1293)
T KOG0996|consen 531 LASSESLKEKKTELDDLKEELPSLKQELKEKEKELPKLRKEERNLKSQLNKLRQRVEEAKSSLSSSRSRNKVLDALMRLK 610 (1293)
T ss_pred HHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999998888888888999999999
Q ss_pred hcCCCCcceeecccccccChhHHHHHHHhcCCCCeEEEcchHHHHHHHHHHHhcCCCceeEEecccccccccccccCCCC
Q 000833 570 ESNQIEGIYGRMGDLGAIDAKYDIAVSTACPGLDYIVVETTSAAQACVELLRREKLGVATFMILEKQVDLFPKMKEHFST 649 (1263)
Q Consensus 570 ~~~~~~g~~g~l~~l~~~~~~~~~aie~~lg~L~~~vV~~~~~a~~~i~~lk~~~~g~~~~~~l~~~~~~~~~~~~~~~~ 649 (1263)
..+.++||+|+||||+.++++|..||.++|++|+++||++.++|..||.+|++.++|++||++||.+.... ....++.+
T Consensus 611 esG~i~Gf~GRLGDLg~Id~kYDvAIsTac~~LdyiVVdt~e~aq~cI~fl~~~nLgraTFi~LDki~~~~-~~l~~i~t 689 (1293)
T KOG0996|consen 611 ESGRIPGFYGRLGDLGAIDEKYDVAISTACARLDYIVVDTIETAQECINFLKKNNLGRATFIILDKIKDHQ-KKLAPITT 689 (1293)
T ss_pred HcCCCCccccccccccccchHHHHHHHHhccccceEEeccHHHHHHHHHHHHHcCCCceeEEehHhhhhhh-hccCCCCC
Confidence 99999999999999999999999999998878999999999999999999999999999999999986432 12344667
Q ss_pred CCcccccccccccCchhHHHHHHHHhcCeEEecChHHHHHHHhcCCCCcceEEeeCCceeecCccccCCCCCCCCCCCCc
Q 000833 650 PENVPRLFDLIKVKDERMKLAFYAAMGNTLVAKDLDQATRIAYSGNKEFRRVVTLDGALFEKSGTMSGGGSKPRGGKMGT 729 (1263)
Q Consensus 650 ~~~~~~l~d~i~~~~~~~~~~~~~~l~~~lv~~~~e~a~~~~~~~~~~~~~~vTldG~~i~~~G~i~Gg~~~~~~~~i~~ 729 (1263)
|.++|+++|+|.|.||.++++|++++++|+||++++.|.+++|++++- ++|||++|.+|.++|+||||+....+|.+|.
T Consensus 690 penvPRLfDLv~~~d~~~r~aFYfaLrdtLV~d~LeQAtRiaygk~rr-~RVvTL~G~lIe~SGtmtGGG~~v~~g~mg~ 768 (1293)
T KOG0996|consen 690 PENVPRLFDLVKCKDEKFRPAFYFALRDTLVADNLEQATRIAYGKDRR-WRVVTLDGSLIEKSGTMTGGGKKVKGGRMGT 768 (1293)
T ss_pred CCCcchHhhhhccCCHHHHHHHHHHHhhhhhhcCHHHHHHHhhcCCCc-eEEEEecceeecccccccCCCCcCCCCCCCC
Confidence 788999999999999999999999999999999999999999987521 7899999999999999999998777777765
Q ss_pred cCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000833 730 SIRPTSVSAEAIINAEKELSAMVDNLSRIRQKIADAVKHYQASEKAVAHLEMELAKSRKEIESLKSQHSYLEKQLDSLKA 809 (1263)
Q Consensus 730 ~~~~~~~~~~~i~~l~~el~~l~~~l~~l~~~~~~l~~~l~~~~~~~~~l~~~l~~~~~~l~~~~~~~~~~~~~l~~l~~ 809 (1263)
..+..-.....+..++.+++........+..++..+...+..+...+..+...++.+..++..+-..+..++.++.++..
T Consensus 769 ~~~~t~~s~~~v~~le~~l~~~~~~~~~~~~~~~~~ee~~~~lr~~~~~l~~~l~~~~~~~k~~~~~~~~l~~~i~~~E~ 848 (1293)
T KOG0996|consen 769 SIRVTGVSKESVEKLERALSKMSDKARQHQEQLHELEERVRKLRERIPELENRLEKLTASVKRLAELIEYLESQIAELEA 848 (1293)
T ss_pred ccccCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 54322356788899999999999888888888888888888888888888888888888888888888888888888888
Q ss_pred hcCCCcchHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000833 810 ASEPRKDEIDRLEELQKIISAEEKEIEKIVNGSKDLKEKALQLQSKVENAGGEKLKAQKLKVDKIQSDIDKSSTEINRHK 889 (1263)
Q Consensus 810 ~~~~~~~~~~~i~~l~~~i~~~~~ei~~l~~~l~~~~~~~~~l~~~~~~~~~~~l~~~~~~~~~l~~~~~~l~~~l~~~~ 889 (1263)
..........++..++..++.++.+++++.+.-.. ++++..++..+..+....++..+.+++.+..+++.+...+....
T Consensus 849 ~~~k~~~d~~~l~~~~~~ie~l~kE~e~~qe~~~K-k~~i~~lq~~i~~i~~e~~q~qk~kv~~~~~~~~~l~~~i~k~~ 927 (1293)
T KOG0996|consen 849 AVLKKVVDKKRLKELEEQIEELKKEVEELQEKAAK-KARIKELQNKIDEIGGEKVQAQKDKVEKINEQLDKLEADIAKLT 927 (1293)
T ss_pred HhhhccCcHHHHHHHHHHHHHHHHHHHHHHHhhhH-HHHHHHHHHHHHHhhchhhHHhHHHHHHHHHHHHHHHHHHHHhH
Confidence 75555555567778888899999999988744444 68888999999988888888889999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000833 890 VQIETAQKMIKKLTKGIAESKKEKEQLVEERVKMERIFDEILEKAHNVQEHYTNTQKLIDQHRDVLDKAKNDYEKLKKTV 969 (1263)
Q Consensus 890 ~~~~~le~~l~~~~~~l~~l~~~~~~~~~el~~l~~~i~~~~~~~~~~~~~l~~~~~~l~~~~~~l~~~~~~~~~l~~~~ 969 (1263)
..+......+......+..+...+.....+++.+...+..+.....++..++.+..+-+.++.+.+......++.+....
T Consensus 928 ~~i~~s~~~i~k~q~~l~~le~~~~~~e~e~~~L~e~~~~~~~k~~E~~~~~~e~~~~~~E~k~~~~~~k~~~e~i~k~~ 1007 (1293)
T KOG0996|consen 928 VAIKTSDRNIAKAQKKLSELEREIEDTEKELDDLTEELKGLEEKAAELEKEYKEAEESLKEIKKELRDLKSELENIKKSE 1007 (1293)
T ss_pred HHHhcCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99988888888888888888888888888888888888888888888888888888888888888888888888888877
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHh-hhhhhhhhccCChhhHHhhhhhhhhhchhhHHHHHH
Q 000833 970 DELRASEIEADYKLQDLKRSYKELEMRGKGYKKRLDDLQITLL-KHLEQIQKDLVDPEKLQATLADQTLSDACDLKRTLE 1048 (1263)
Q Consensus 970 ~~~~~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~l~~l~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ 1048 (1263)
.++......+...++.+...+..+...+......++.+..... +....... ....++.+........+.+
T Consensus 1008 ~~lk~~rId~~~K~e~~~~~l~e~~~~~~~~~k~~~~l~~~~~tE~~~~~~~---------~~~~~Eeleae~~~~~i~e 1078 (1293)
T KOG0996|consen 1008 NELKAERIDIENKLEAINGELNEIESKIKQPEKELKKLSLCNMTETRPQIEL---------DVESPEELEAEMLEDNINE 1078 (1293)
T ss_pred HHHHHhhccHHHHHHHHHHHHHHHHhhhhhHHHhhCccccccchhhcccccc---------ccCChHHHHhhhcHhhHHH
Confidence 7777755567777777777777777766665554444322111 00000000 0011111111111122445
Q ss_pred HHHHHHHHHHHc-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 000833 1049 MVALLEAQLKEL-NPNLDSITEYRRKVAAYNERVEDLTTVTQQRDDVKKQYDEWRKKRLDEFMAGFNAISLKLKEMYQMI 1127 (1263)
Q Consensus 1049 ~i~~l~~~i~~l-~~nl~~~~e~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~l~~~~~~~f~~~~~~~~~~~~~~~~~l 1127 (1263)
.+..++..+..+ .|++..+.+|......|...+..++.....+++..+.+..++..+.+.||..|.-|+..+.++|+.+
T Consensus 1079 ~i~~lE~~~~~l~~vd~~~i~eY~~k~~~y~~rv~~l~~~t~kr~~~re~l~~Lrk~RldEFm~gf~~Is~kLkemYQmI 1158 (1293)
T KOG0996|consen 1079 KIALLEKRVEELREVDLGVIAEYAKKVELYLKRVAELEKFTQKRDEHREKLEELRKRRLDEFMAGFNIISMKLKEMYQMI 1158 (1293)
T ss_pred HHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 778888899999 8999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCccEEEEecCCCCcccccceeeecCCCccccccccCChhHHHHHHHHHHHHhccCCCCCeEEeecCcCCCCHHHHHHH
Q 000833 1128 TLGGDAELELVDSLDPFSEGVVFSVRPPKKSWKNIANLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFKNVSIV 1207 (1263)
Q Consensus 1128 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lSGGek~~~~la~~~a~~~~~~~p~~ilDE~d~~ld~~~~~~~ 1207 (1263)
++||+++|.+.++.|||..||.|+|.||.+.|+.+..||||||++.+|||+||++.|+|+||||+|||||+||..|+..|
T Consensus 1159 T~GGdAeLElVDslDPFseGV~FSVrPpKKSWK~I~NLSGGEKTLSSLALVFALH~YkPTPlYVMDEIDAALDfkNVSIV 1238 (1293)
T KOG0996|consen 1159 TLGGDAELELVDSLDPFSEGVMFSVRPPKKSWKNISNLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFKNVSIV 1238 (1293)
T ss_pred hcCCcceeEeeccCCCcccCceEEeeCchhhhhhcccCCcchhHHHHHHHHHHHHccCCCCceehhhHHHhhccccchhH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhcCCCeEEEEEcchhHHHhcceeEEEEecCCCceeEEecCCccccc
Q 000833 1208 GHYVKDRTKDAQFIIISLRNNMFELADRLVGIYKTDNCTKSITINPGSFTVC 1259 (1263)
Q Consensus 1208 ~~~l~~~~~~~q~i~ith~~~~~~~ad~~~~v~~~~~~s~~~~~~~~~~~~~ 1259 (1263)
+.+|+++.++.||||||.+.+||++|+|++||++-.++|++|+|+|....+|
T Consensus 1239 anYIkErTkNAQFIIISLRnnMFELa~rLvGIYKtdn~Tksvti~~~~i~~~ 1290 (1293)
T KOG0996|consen 1239 ANYIKERTKNAQFIIISLRNNMFELANRLVGIYKTDNCTKSVTINPVEIAIL 1290 (1293)
T ss_pred HHHHHHhccCCeEEEEEehhhHHHHHhhheeeEeecCccceeEechhhhhhc
Confidence 9999999999999999999999999999999999999999999997666554
|
|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage | Back alignment and domain information |
|---|
| >PRK00064 recF recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >PRK14079 recF recombination protein F; Provisional | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PF06470 SMC_hinge: SMC proteins Flexible Hinge Domain; InterPro: IPR010935 This entry represents the hinge region of the SMC (Structural Maintenance of Chromosomes) family of proteins | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms | Back alignment and domain information |
|---|
| >TIGR00611 recf recF protein | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PRK00064 recF recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG3950 Predicted ATP-binding protein involved in virulence [General function prediction only] | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00611 recf recF protein | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PF11398 DUF2813: Protein of unknown function (DUF2813); InterPro: IPR022602 This entry contains YbjD from Escherichia coli (strain K12), which is a conserved protein with a nucleotide triphosphate binding domain | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage | Back alignment and domain information |
|---|
| >KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG1106 Predicted ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14079 recF recombination protein F; Provisional | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG4637 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13175 AAA_15: AAA ATPase domain | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >COG3593 Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4637 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1263 | ||||
| 3l51_B | 166 | Crystal Structure Of The Mouse Condensin Hinge Doma | 6e-41 | ||
| 1w1w_A | 430 | Sc Smc1hd:scc1-c Complex, Atpgs Length = 430 | 1e-31 | ||
| 1xew_Y | 172 | Structural Biochemistry Of Atp-Driven Dimerization | 1e-28 | ||
| 1xex_B | 172 | Structural Biochemistry Of Atp-Driven Dimerization | 3e-28 | ||
| 3kta_B | 173 | Structural Basis For Adenylate Kinase Activity In A | 1e-26 | ||
| 4i99_A | 354 | Crystal Structure Of The Smchead Bound To The C-win | 6e-25 | ||
| 3zgx_A | 426 | Crystal Structure Of The Kleisin-n Smc Interface In | 1e-23 | ||
| 1xew_X | 182 | Structural Biochemistry Of Atp-Driven Dimerization | 8e-17 | ||
| 3kta_A | 182 | Structural Basis For Adenylate Kinase Activity In A | 2e-15 | ||
| 1e69_A | 322 | Smc Head Domain From Thermotoga Maritima Length = 3 | 1e-14 | ||
| 2wd5_A | 233 | Smc Hinge Heterodimer (Mouse) Length = 233 | 1e-09 | ||
| 3aux_A | 371 | Crystal Structure Of Rad50 Bound To Adp Length = 37 | 9e-06 | ||
| 1gxl_A | 213 | Smc Hinge Domain From T. Maritima With Coiled Coil | 2e-05 | ||
| 1gxj_A | 186 | Smc Hinge Domain From T. Maritima WO COILED COIL Le | 4e-05 | ||
| 3nwc_A | 189 | Crystal Structure Of The Pyrococcus Furiosus Smc Pr | 6e-05 |
| >pdb|3L51|B Chain B, Crystal Structure Of The Mouse Condensin Hinge Domain Length = 166 | Back alignment and structure |
|
| >pdb|1W1W|A Chain A, Sc Smc1hd:scc1-c Complex, Atpgs Length = 430 | Back alignment and structure |
| >pdb|1XEW|Y Chain Y, Structural Biochemistry Of Atp-Driven Dimerization And Dna Stimulated Activation Of Smc Atpases Length = 172 | Back alignment and structure |
| >pdb|1XEX|B Chain B, Structural Biochemistry Of Atp-Driven Dimerization And Dna Stimulated Activation Of Smc Atpases Length = 172 | Back alignment and structure |
| >pdb|3KTA|B Chain B, Structural Basis For Adenylate Kinase Activity In Abc Atpases Length = 173 | Back alignment and structure |
| >pdb|4I99|A Chain A, Crystal Structure Of The Smchead Bound To The C-winged Helix Domain Of Scpa Length = 354 | Back alignment and structure |
| >pdb|3ZGX|A Chain A, Crystal Structure Of The Kleisin-n Smc Interface In Prokaryotic Condensin Length = 426 | Back alignment and structure |
| >pdb|1XEW|X Chain X, Structural Biochemistry Of Atp-Driven Dimerization And Dna Stimulated Activation Of Smc Atpases. Length = 182 | Back alignment and structure |
| >pdb|3KTA|A Chain A, Structural Basis For Adenylate Kinase Activity In Abc Atpases Length = 182 | Back alignment and structure |
| >pdb|1E69|A Chain A, Smc Head Domain From Thermotoga Maritima Length = 322 | Back alignment and structure |
| >pdb|2WD5|A Chain A, Smc Hinge Heterodimer (Mouse) Length = 233 | Back alignment and structure |
| >pdb|3AUX|A Chain A, Crystal Structure Of Rad50 Bound To Adp Length = 371 | Back alignment and structure |
| >pdb|1GXL|A Chain A, Smc Hinge Domain From T. Maritima With Coiled Coil Length = 213 | Back alignment and structure |
| >pdb|1GXJ|A Chain A, Smc Hinge Domain From T. Maritima WO COILED COIL Length = 186 | Back alignment and structure |
| >pdb|3NWC|A Chain A, Crystal Structure Of The Pyrococcus Furiosus Smc Protein Hinge Domain Length = 189 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1263 | |||
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 2e-81 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 4e-53 | |
| 3l51_B | 166 | Structural maintenance of chromosomes protein 4; s | 8e-68 | |
| 1gxj_A | 186 | SMC, chromosome segregation SMC protein; SMC dimer | 8e-58 | |
| 2wd5_A | 233 | Structural maintenance of chromosomes protein 1A; | 7e-56 | |
| 1gxl_A | 213 | SMC, chromosome segregation SMC protein; SMC dimer | 5e-55 | |
| 3nwc_A | 189 | SMC protein; structural maintenance of chromosomes | 8e-44 | |
| 2wd5_B | 213 | Structural maintenance of chromosomes protein 3; D | 5e-39 | |
| 3kta_B | 173 | Chromosome segregation protein SMC; structural mai | 7e-37 | |
| 3l51_A | 161 | Structural maintenance of chromosomes protein 2; s | 4e-31 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 1e-29 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 1e-20 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 3e-26 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-20 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 8e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-18 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-06 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 2e-13 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 2e-12 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 2e-13 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 7e-12 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-06 | |
| 2xs1_A | 704 | Programmed cell death 6-interacting protein; prote | 3e-08 | |
| 2xs1_A | 704 | Programmed cell death 6-interacting protein; prote | 1e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-08 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-05 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 7e-08 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 5e-07 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 6e-07 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 1e-06 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 2e-05 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 7e-06 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 2e-05 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 5e-04 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 1e-04 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 7e-04 |
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
Score = 273 bits (699), Expect = 2e-81
Identities = 79/306 (25%), Positives = 150/306 (49%), Gaps = 17/306 (5%)
Query: 964 KLKKTVDELRASEIEAD-YKLQDLKRSYKELEMRGKGYKKRLDDLQITLLKHLEQIQKDL 1022
K L I + +++ + R+ + +++ ++ ++
Sbjct: 127 SYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFEEVSGSIQYKKEYEELK 186
Query: 1023 VDPEKLQATLADQTLSDACDLKRTLEMVALLEAQLKELNPNLDSITEYRRKVAAYNERVE 1082
EKL + + + +R + ++ E+ + Y +
Sbjct: 187 EKIEKLSKSATE----SIKNRRRIHGELKTYKSPGLEVLFQGPRGSRYDEAEGRFEVINN 242
Query: 1083 DLTTVTQQRDDVKKQYDEWRKKRLDEFMAGFNAISLKLKEMYQMIT---------LGGDA 1133
+ + + + Q+ + +KKR + F F+ +S L +Y+ +T GG+A
Sbjct: 243 ETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNA 302
Query: 1134 ELELVDSLDPFSEGVVFSVRPPKKSWKNIANLSGGEKTLSSLALVFALHHYKPTPLYVMD 1193
L + D +PF+ G+ + PP K +K++ LSGGEKT+++LAL+FA++ Y+P+P +V+D
Sbjct: 303 SLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLD 362
Query: 1194 EIDAALDFKNVSIVGHYVKD-RTKDAQFIIISLRNNMFELADRLVGIYKT--DNCTKSIT 1250
E+DAALD NV + Y++ R D QFI+ISL+N MFE +D LVG+Y+ +N +K IT
Sbjct: 363 EVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIIT 422
Query: 1251 INPGSF 1256
++ ++
Sbjct: 423 LDLSNY 428
|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
| >3l51_B Structural maintenance of chromosomes protein 4; structural maintenance of chromosomes (SMC), hinge domain, C cycle, cell division, cytoplasm; 1.51A {Mus musculus} Length = 166 | Back alignment and structure |
|---|
| >1gxj_A SMC, chromosome segregation SMC protein; SMC dimerisation domain, anti parallel coiled coil, SMC proteins; 2.0A {Thermotoga maritima} SCOP: d.215.1.1 PDB: 1gxk_A Length = 186 | Back alignment and structure |
|---|
| >2wd5_A Structural maintenance of chromosomes protein 1A; DNA damage, cell cycle, cell division; 2.70A {Mus musculus} Length = 233 | Back alignment and structure |
|---|
| >1gxl_A SMC, chromosome segregation SMC protein; SMC dimerisation domain, anti parallel coiled coil, SMC proteins; 3.0A {Thermotoga maritima} SCOP: d.215.1.1 Length = 213 | Back alignment and structure |
|---|
| >3nwc_A SMC protein; structural maintenance of chromosomes (SMC), SMC hinge domai dimerization, DNA binding, cell cycle; 1.70A {Pyrococcus furiosus} Length = 189 | Back alignment and structure |
|---|
| >2wd5_B Structural maintenance of chromosomes protein 3; DNA damage, cell cycle, cell division; 2.70A {Mus musculus} Length = 213 | Back alignment and structure |
|---|
| >3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Length = 173 | Back alignment and structure |
|---|
| >3l51_A Structural maintenance of chromosomes protein 2; structural maintenance of chromosomes (SMC), hinge domain, C cycle, cell division, cytoplasm; 1.51A {Mus musculus} Length = 161 | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Length = 322 | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Length = 322 | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Length = 182 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Length = 203 | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Length = 149 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Length = 365 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Length = 409 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Length = 359 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1263 | ||||
| d1gxja_ | 161 | d.215.1.1 (A:) Smc hinge domain {Thermotoga mariti | 3e-42 | |
| d1w1wa_ | 427 | c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac | 4e-30 | |
| d1w1wa_ | 427 | c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac | 4e-30 | |
| g1xew.1 | 329 | c.37.1.12 (X:,Y:) Smc head domain {Pyrococcus furi | 3e-27 | |
| g1xew.1 | 329 | c.37.1.12 (X:,Y:) Smc head domain {Pyrococcus furi | 7e-24 | |
| d1e69a_ | 308 | c.37.1.12 (A:) Smc head domain {Thermotoga maritim | 3e-21 | |
| d1e69a_ | 308 | c.37.1.12 (A:) Smc head domain {Thermotoga maritim | 4e-20 | |
| g1ii8.1 | 369 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 1e-11 | |
| g1ii8.1 | 369 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 1e-09 | |
| d1qhla_ | 222 | c.37.1.12 (A:) Cell division protein MukB {Escheri | 6e-10 | |
| g1f2t.1 | 292 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 2e-06 | |
| g1f2t.1 | 292 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 2e-04 | |
| d3b60a1 | 253 | c.37.1.12 (A:329-581) Multidrug resistance ABC tra | 1e-04 | |
| d2hyda1 | 255 | c.37.1.12 (A:324-578) Putative multidrug export AT | 3e-04 | |
| d2pmka1 | 241 | c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro | 5e-04 | |
| d1mv5a_ | 242 | c.37.1.12 (A:) Multidrug resistance ABC transporte | 0.001 |
| >d1gxja_ d.215.1.1 (A:) Smc hinge domain {Thermotoga maritima [TaxId: 2336]} Length = 161 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Smc hinge domain superfamily: Smc hinge domain family: Smc hinge domain domain: Smc hinge domain species: Thermotoga maritima [TaxId: 2336]
Score = 150 bits (379), Expect = 3e-42
Identities = 44/158 (27%), Positives = 74/158 (46%), Gaps = 5/158 (3%)
Query: 562 LKAILQAKESNQIEGIYGRMGDLGAIDAKYDIAVSTACPG-LDYIVVETTSAAQACVELL 620
++A+ + KE + G+ + +L +D KY +AVS G IVV A+A VE L
Sbjct: 6 VRAVFEEKE--RFPGLVDVVSNLIEVDEKYSLAVSVLLGGTAQNIVVRNVDTAKAIVEFL 63
Query: 621 RREKLGVATFMILEKQVDLFPKMKEHFSTPENVPRLFDLIKVKDERMKLAFYAAMGNTLV 680
++ + G T + L+ F ++ + V DL+K +++ GN++V
Sbjct: 64 KQNEAGRVTILPLDLIDGSFNRISGLENERGFVGYAVDLVKF-PSDLEVLGGFLFGNSVV 122
Query: 681 AKDLDQATRIAYSGNKEFRRVVTLDGALFEKSGTMSGG 718
+ LD A R+ R+ TLDG L G ++GG
Sbjct: 123 VETLDDAIRMKKKYRLNT-RIATLDGELISGRGAITGG 159
|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Length = 308 | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Length = 308 | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Length = 222 | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1263 | |||
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 100.0 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 99.93 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 99.92 | |
| d1gxja_ | 161 | Smc hinge domain {Thermotoga maritima [TaxId: 2336 | 99.85 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.75 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 99.74 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 99.68 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.66 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.62 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 99.51 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.49 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 99.46 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 99.46 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 99.45 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 99.44 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 99.44 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 99.44 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 99.43 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 99.42 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 99.41 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 99.41 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 99.4 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.4 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 99.39 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 99.38 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 99.38 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 99.38 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 99.36 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 99.26 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 99.23 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 99.02 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 98.08 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 97.86 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 97.83 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 97.82 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 97.8 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 97.75 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 97.73 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 97.71 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 97.6 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 97.52 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 97.52 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 97.47 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 97.4 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 97.34 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 97.34 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 97.29 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 97.24 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 97.13 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 97.08 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 97.01 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 96.65 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 95.47 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 95.44 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 95.22 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.21 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 94.87 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 94.76 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 94.67 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 94.56 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 94.45 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 94.23 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 94.12 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 94.0 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 93.91 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 93.72 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.7 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 93.62 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 93.6 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 93.51 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 93.36 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 93.33 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 93.24 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 93.16 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 92.59 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 92.42 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 92.22 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 92.21 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 92.06 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 92.01 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 91.85 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 91.8 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 91.76 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 91.75 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 91.67 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 91.63 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 91.61 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 91.49 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 91.44 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 91.39 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 91.23 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 91.1 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 91.09 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 90.92 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 90.91 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 90.89 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 90.89 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 90.71 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 90.71 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 90.64 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 90.51 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 90.51 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 90.17 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 90.12 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 90.09 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 90.05 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 90.03 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 89.6 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 89.54 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 89.2 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 89.14 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 89.04 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 88.94 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 88.92 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 88.9 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 88.87 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 88.75 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 88.65 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 88.54 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 88.53 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 88.48 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 88.47 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 88.23 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 88.13 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 88.12 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 87.72 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 87.69 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 87.58 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 87.56 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 87.49 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 87.47 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 87.44 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 87.32 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 87.17 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 87.1 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 87.09 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 86.92 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 86.88 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 86.75 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 86.69 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 86.62 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 86.62 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 86.46 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 86.38 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 86.23 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 86.1 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 86.07 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 86.04 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 85.95 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 85.9 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 85.5 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 85.47 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 85.46 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 85.37 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 85.32 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 85.22 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 85.07 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 85.03 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 84.83 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 84.82 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 84.63 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 84.49 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 84.45 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 84.31 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 84.3 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 84.06 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 83.94 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 83.73 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 83.65 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 83.29 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 83.14 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 83.0 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 82.98 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 82.96 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 82.94 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 82.91 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 82.89 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 82.82 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 82.75 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 82.67 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 82.4 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 82.14 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 81.5 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 81.5 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 81.4 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 81.37 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 81.23 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 81.1 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 80.93 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 80.8 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 80.79 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 80.77 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 80.15 |
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Smc head domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00 E-value=3.1e-40 Score=303.93 Aligned_cols=167 Identities=27% Similarity=0.483 Sum_probs=132.1
Q ss_pred EEEEEEEECCCCCCCCCCCCCCCC-CCCEEEECCCCCCHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCCCCCEEE
Q ss_conf 389888853753347972213677-7626887689998347999999981845102310012332323545788871189
Q 000833 20 LFIKEMVMRNFKSYAGEQRVGPFH-KSFSAVVGPNGSGKSNVIDAMLFVFGKRAKQMRLNKVSELIHNSTNYQNLDSAGV 98 (1263)
Q Consensus 20 m~i~~i~l~nFks~~~~~~~~~f~-~~~~~i~G~NGsGKS~i~~ai~~~~g~~~~~~r~~~~~~~i~~g~~~~~~~~a~v 98 (1263)
|+|++|.|.||+||++.+.| +|. +|||+|+|||||||||||+||+||||.+++.+|+.++.++||.| ...+.+
T Consensus 1 ~ki~~l~l~NFks~~~~~~i-~f~~~~l~~i~G~NGsGKS~ileAi~~~lg~~~~~~R~~~~~dli~~g-----~~~~~~ 74 (427)
T d1w1wa_ 1 GRLVGLELSNFKSYRGVTKV-GFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLIYRG-----VLNDEN 74 (427)
T ss_dssp CCEEEEEEESCSSCCSEEEE-ECTTCSEEEEECSTTSSHHHHHHHHHHHTTC---------CGGGSCCC-----------
T ss_pred CEEEEEEEECEEEECCCEEE-ECCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHEECC-----CCCCCC
T ss_conf 92889999494410798797-589999899999999988999999999857785100233406652468-----767751
Q ss_pred EEEEEECCCCCCCC-------CCCCCCCEEEEEEEEECCCCCEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCHHHHH
Q ss_conf 99872010368875-------43447856899988632998208886941499999999981899988875442313498
Q 000833 99 SVHFQEIVDLDDGT-------YEAIQGSDFVISRVAFRDNSSKYYINDRPSNFTEVTKKLKGKGVDLDNNRFLILQGEVE 171 (1263)
Q Consensus 99 ~~~~~~~~~~~~~~-------~~~~~~~~~~i~r~~~~~~~s~y~in~~~~~~~~~~~~~~~~~i~~~~~~~~i~qg~v~ 171 (1263)
...|.+........ +....+..+.+.|.+..+|.+.|+|||++++.+++..++...|+.+.+|++++.||++.
T Consensus 75 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i~r~i~~~~~~~~~in~~~~~~~~i~~~~~~~~~~~~~~~~~i~q~~~~ 154 (427)
T d1w1wa_ 75 SDDYDNEGAASSNPQSAYVKAFYQKGNKLVELMRIISRNGDTSYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVE 154 (427)
T ss_dssp -------------CCEEEEEEEEEETTEEEEEEEEEETTSCEEEEETTEEECHHHHHHHHHHTTCCTTTCTTEECTTCTT
T ss_pred EEEEEEECCCCCCCCCCCEEEEECCCCCEEEEEEEECCCCCEEEECCCCCCCHHHHHHHHHHCCCCCCCCCCEECHHHHH
T ss_conf 28987412334442000112453058927999999725896367027644429999999987087878865242204566
Q ss_pred HHHHCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf 9881599988999511799999974024
Q 000833 172 QISLMKPKGQGPHDEGFLEYLEDIIGTD 199 (1263)
Q Consensus 172 ~~~~~~p~~~~~~~~~~~~~~e~~~g~~ 199 (1263)
.++.++|. +++.+++.++|+.
T Consensus 155 ~~~~~~~~-------~~~~~le~~~~~~ 175 (427)
T d1w1wa_ 155 QIAAQSPV-------ELSRMFEEVSGSI 175 (427)
T ss_dssp HHHHSCHH-------HHHHTC-------
T ss_pred HHHHCCCC-------CCCCCCCCCCCCC
T ss_conf 66640653-------1223222233332
|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gxja_ d.215.1.1 (A:) Smc hinge domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|