Citrus Sinensis ID: 000836

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260--

MALGDLMASRFSQSAVVSNHLNDDCGSAHGDVDLRRDSDTASSSYTNNASVTTITTTTTTSLAYLPQTVVLCELRHEAFEASTPSGPSDSGLVSKWRPKDRMKTGCVALVLCLNISVDPPDVIKISPCARMECWIDPFSMAPQKALETIGKNLSQQYERWQPRARYKVQLDPTVDEVKKLCNTCRRYAKGERVLFHYNGHGVPKPTANGEIWLFNKSYTQYIPLPISDLDSWLKTPSIYVFDCSAAGMIVNAFIELHDWGASNYSGSTRDCILLAACEAHETLPQSEEFPADVFTSCLTTPITMALRWFCKRSLLHESLDYSLIDKIPGRQTDRRTLLGELNWIFTAVTDTIAWNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMRSANCSPISHPMLPPTHQHHMWDAWDMAAEICLSQLPSLVADPNAEYQPSPFFSEQLTAFEVWLDHGSEHKKPPEQLPIVLQVLLSQCHRFRALVLLGRFLDMGPWAVDLALSVGIFPYVLKLLQTTTPELRQILVFIWTKILALDKSCQVDLVKDGGHAYFIRFLDSMEAYPEQRAMAAFVLAVIVDGHRRGQEACIEAGLIHVCLKHLQGSMPNDAQTEPLFLQWLCLCLGKLWEDFTEAQTIGRRADAPAIYVPLLSEPQPEVRASAVFSLGTLLDIGFDSCRDGVEGDEECDDDEKIRAEISIIRSLLTVVSDGSPLVRAEVAVALARFAFGHKQHLKSIAAAYSKPQSNSLLGSLPSLAHIKTTGSGSIVSSQIGPLTRVGNEAVVRDGRVSTSSPLANAGLMHGSPLSDDSSQHSDSGILNDGVSNGVVNHMRPKPLDSAIYSQCVLAMCTLAKDPSPRIATLGRRVLSIIGIEQVVTKPVMSMGNTSRPGDPTTAAPTPSLAGLVRSSSWFDMNGGHLPLKFRTPPVSPPRQSFLPGMRRVCSLEFRPHLINSPDSGLADPLLGSGDPSAVSERSLLPPSTIYNWSCGHFSKPLLTAADDTEEILARREEREKFALEHIAKCQRSSVSKLNNPIACWDTRFEKGTKTALLQPFSPIVVAADENERIKIWNYEEDTLLNSFDNHDFPDKGISKLCLVNELDVSLLLVASCNGNIRIWKDYDQKDKQKLVTAFSSIQGHKPGVRCSNVVVDWQQQSGYLYASGEVSSIMLWDLEKEQQMVNPIPSSSDCSISALTASQVHGGQLAAGFVDGSVRLYDVRTPDMLVCSTRPHTQQVERVVGISFQPGLDPAKVNGTPKCLPSFSDLIYFLAS

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccEECccccHHHHHHHHHHHHccccccEEEEEEccccccccccccEEEEEcccccccccccHHHHHHHccccEEEEEEcccccHHHHHHHHHHHcccccccccccccEEEEEccccccccccccccccHHHHccccHHHHHHHHHHHHccccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEECccccccCEEEEEcccccEEEEEccccEEEEEEcccccccccccccccccccEEEEEEEEcccccEEEEEEccccEEEEEcccccccccEEEccccccccccccccccEEEEEEccccEEEEEcccccEEEEEccccccccccccccccccEEEEEECcccccEEEEECccccEEEEEccccccccccccccccccccEEEEECccccccCEEECcccccEEEEEccccccc

*********************************************************TTTSLAYLPQTVVLCELRHE**********************DRMKTGCVALVLCLNISVDPPDVIKISPCARMECWIDPFSMAPQKALETIGKNLSQQYERWQPRARYKVQLDPTVDEVKKLCNTCRRYAKGERVLFHYNGHGVPKPTANGEIWLFNKSYTQYIPLPISDLDSWLKTPSIYVFDCSAAGMIVNAFIELHDWGASNYSGSTRDCILLAACEAHETLPQSEEFPADVFTSCLTTPITMALRWFCKRSLLHESLDYSLIDKIPGRQTDRRTLLGELNWIFTAVTDTIAWNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMRSANCSPISHPMLPPTHQHHMWDAWDMAAEICLSQLPSLVADPNAEYQPSPFFSEQLTAFEVWLDHG********QLPIVLQVLLSQCHRFRALVLLGRFLDMGPWAVDLALSVGIFPYVLKLLQTTTPELRQILVFIWTKILALDKSCQVDLVKDGGHAYFIRFLDSMEAYPEQRAMAAFVLAVIVDGHRRGQEACIEAGLIHVCLKHLQGSMPNDAQTEPLFLQWLCLCLGKLWEDFTEAQTIGRRADAPAIYVPLLSEPQPEVRASAVFSLGTLLDIGFDS*************DEKIRAEISIIRSLLTVVSDGSPLVRAEVAVALARFAFGHKQHLKSIAAAYS********************************************************************************************PLDSAIYSQCVLAMCTLAKDPSPRIATLGRRVLSIIGIEQVVT******************************************************************************************************STIYNWSCGHFSKPLLTAADDTEEILAR***REKFALEHIAKCQRSSVSKLNNPIACWDTRFEKGTKTALLQPFSPIVVAADENERIKIWNYEEDTLLNSFDNHDFPDKGISKLCLVNELDVSLLLVASCNGNIRIWKDYDQKDKQKLVTAFSSIQGHKPGVRCSNVVVDWQQQSGYLYASGEVSSIMLWDLEKEQQMVNPIPSSSDCSISALTASQVHGGQLAAGFVDGSVRLYDVRTPDMLVCSTRPHTQQVERVVGISFQPGLDPAKVNGTPKCLPSFSDLIYFLA*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Regulatory-associated protein of TOR 1	Probable component of the plant TOR kinase pathway that recruits substrates for TOR. Modulates plant cell growth and regulates the activity of ATPK1 kinase in response to osmotic stress.	confident	Q93YQ1
Regulatory-associated protein of TOR 2	Probable component of the plant TOR kinase pathway.	confident	C7J8E5
Regulatory-associated protein of TOR 1	Probable component of the plant TOR kinase pathway.	probable	Q0IQN5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SFZ, chain A
Confidence level:probable
Coverage over the Query: 1046-1211
View the alignment between query and template
View the model in PyMOL

Template: 2Z6G, chain A
Confidence level:probable
Coverage over the Query: 472-663,681-733,744-849
View the alignment between query and template
View the model in PyMOL

Template: 1WA5, chain B
Confidence level:probable
Coverage over the Query: 430-664,681-733
View the alignment between query and template
View the model in PyMOL

Template: 3EI3, chain B
Confidence level:probable
Coverage over the Query: 1030-1236
View the alignment between query and template
View the model in PyMOL

Template: 3GRE, chain A
Confidence level:probable
Coverage over the Query: 1046-1239
View the alignment between query and template
View the model in PyMOL