Citrus Sinensis ID: 000913

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------
MEGTHDIFMASTSLRRSASRWNTNSIGAFSRSSREEDDEEALKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSSNHNTRSGSTDDIRGQQSSSQSLSLAEAEASRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRT
cccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHcccccccccccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccEEEEEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHcccccccccccccccccCEECccEEEEEEccccccHHHHHHHHHccccccccEEEEEEEccccccccccccEEEEEcccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHccccEEEEcccCEEEEccHHHHHHHHHcccccccccccccccccccccccccEEcccccccccccccHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcHHHHHHHHHHHcccccccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEHHccccccccccccccEEccccccccccccccccccccccccccccHHHHHHHccccccccccccccccEEEEccEEEEEcccccHHccccccccccccccccCEECcccEEEccccccccHHHHHHHHHccccccEEEEEEEEccccccccccccccccHHcccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHcHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHcccccccccccccccHHHHHHccccccccccccHHHHHcccHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccc
*****************************************LKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKIS***************ALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVI****************************************************************LPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALI***********DLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGTHDIFMASTSLRRSASRWNTNSIGAFSRSSREEDDEEALKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSSNHNTRSGSTDDIRGQQSSSQSLSLAEAEASRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pleiotropic drug resistance protein 1 May be a general defense protein.probableQ76CU2
Pleiotropic drug resistance protein 1 Excretes secondary metabolites such as terpenes. Involved in both constitutive and jasmonic acid-dependent induced defense. Confers some resistance to sclareol and B.cinerea.probableQ949G3
ABC transporter G family member 40 May be a general defense protein (By similarity). Functions as a pump to exclude Pb(2+) ions and/or Pb(2+)-containing toxic compounds from the cytoplasm. Contributes to Pb(2+) ions resistance. Confers some resistance to the terpene sclareol.probableQ9M9E1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BK7, chain A
Confidence level:confident
Coverage over the Query: 824-1061
View the alignment between query and template
View the model in PyMOL
Template: 2IHY, chain A
Confidence level:confident
Coverage over the Query: 166-252,263-268,287-291,302-413
View the alignment between query and template
View the model in PyMOL
Template: 2NQ2, chain C
Confidence level:confident
Coverage over the Query: 868-924,939-1092
View the alignment between query and template
View the model in PyMOL
Template: 3OZX, chain A
Confidence level:confident
Coverage over the Query: 882-940,953-1064
View the alignment between query and template
View the model in PyMOL
Template: 3OZX, chain A
Confidence level:confident
Coverage over the Query: 882-940,953-1064
View the alignment between query and template
View the model in PyMOL
Template: 1OXS, chain C
Confidence level:probable
Coverage over the Query: 880-1137
View the alignment between query and template
View the model in PyMOL