Citrus Sinensis ID: 000920


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220---
MTMAMTCKLCGSSSSRLSASSKLKKASEPLQGPDRVNRRSTLAFLWLLGFVIVGSICFLLSCDGGAFVGNEEEEGRMSCEKKAQIFLQHSNVSHNQLHALATLFSESDQIASLKCTREPGSGMLLHNGITCAMKVPYSKKQEFQKQSIWLAEDVKQMDQCPVEDVNVSWKLDHSVLKNISHARTWSNCTRDHFKILSFCLFKGCWWFICGMVVICIIVSLLFKSRRNHKHKHDQLQPVSQQRQMILQQKQQQQTPHPPRSAGKWRMKILVVFVLLGIAISVWLFWLLKEKMHLRRKETLASMCDERARMLQDQFNVSMNHVHALAILVSTFHHRKHPSAVDQKTFGEYTERTAFERPLTSGVAYALKVLHSEREQFEKQHGWKIKKMETEDQTLVQDCTPENLDPAPVQDEYAPVIFSQETVSHIVSIDMMSGKEDRENILRARASGKGVLTPPFKLLKSNHLGVVLTFAVYNTDLPQDATPEQRIEATLGYLGASYDVPSLVEKLLHQLASKQTIVVNVYDTTNASAPINMYGPDVTDTGLLRVSNLDFGDPSRKHEMHCRFKQKPPVPWTAINASIGVVVITLLVGHIFHAAINRIAQVENDYHEMMELKARAEAADVAKSQFLATVSHEIRTPMNGVLGMLQMLMDTELDAAQLDYAQTAHNSGKDLISLINDVLDQAKIESGRLEPEFVPFHLHDVLDNVLSLFSSKANQKGIELAIYVSDRVPEVVIGDPGRFRQIITNLVGNSIKFTQDKGHIFVSVHLADDVRSKVDVKDKVLEKSLNSVQHKSDKVYNTLSGFPVVDRWKSWENFKMLDNTNTMEQLGRIKLLVTVEDTGVGIPLEAQVRIFTPFMQADSSTSRTYGGTGIGLSISRCLVELMGGEIGFVSEPGTGSTFSFTVTFTEGERNSLDPKWQQYVPDVSEFRGLRALVIDDKSIRAEVTRYHLQRLEMAVHVANSMQLACSYLSDTCSTSVLPQLALVLIDKDVWDKEIGLVLHYMLKQQRRKGGLEISRNLPKIFLLATSISETDRDELKSDGIVTLLTKPLRLSVLIGCFQEDPESSKKLQQKRKKPSLGHLLKGKQILVVDDNMVNRRVAEGALKKHGAIVTCVDCGRAAVDKLTPPHNFDACFMDLQMPEMDGFQATWQIRHLENEINEQIASGESSAEMFGNVGLWHVPILAMTADVIQASNEQCMKCGMDDYVSKPFEDEQLYTAVARFFMSG
ccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHcccccHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHcccccccccccccccccEEcccccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHcccccccccccEEEEHHHccccEEEEccEEEEEEEcccccccHHHHHHHccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccEEEEEEcccHHHHHHHHHHcccHHHccccccccccccccccccccccccccccEEEccccccEEEEEEcccccccHHHHHHHHHccccEEcccccccccccccEEEEEEEEcccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccccccccccccccCEEEEEECcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccEEcccccHHHHHHHHccccccccccccEEEEEEEEcccccccccccHHHHHHcccccccccccccccccccccccccccccHHHHcccccccccccEEEEEEEEECccccccHHHHHccccccccccccccccccccccHHHHHHHHHHHcccEEEEEEccccccEEEEEEECcccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccccccccEEEEEccccccccHHHHHHHHHHHHHHcccccccccccEEEEEEcccccccHHHHHHccccCECcccccHHHHHHHHHHcccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHcccccccEEEEccccccccHHHHHHHHHHHccccHHHHcccccccccccccccccccEEEEcccccHHHHHHHHHccccccccccccHHHHHHHHHHHcccc
*************************************RRSTLAFLWLLGFVIVGSICFLLSCDGGAFV****************IFLQHSNVSHNQLHALATLFSESDQIASLKCTREPGSGMLLHNGITCAMKVPYSKKQEFQKQSIWLAEDVKQMDQCPVEDVNVSWKLDHSVLKNISHARTWSNCTRDHFKILSFCLFKGCWWFICGMVVICIIVSLLFK***NHK***D*****************************KWRMKILVVFVLLGIAISVWLFWLLKEKMHLRRKETLASMCDERARMLQDQFNVSMNHVHALAILVSTFHHRKHPSAVDQKTFGEYTERTAFERPLTSGVAYALKVLHSEREQFEKQHGWKIKKMETE*************DPAPVQDEYAPVIFSQETVSHIVSIDMMSGKEDRENILRARASGKGVLTPPFKLLKSNHLGVVLTFAVYNTDLPQDATPEQRIEATLGYLGASYDVPSLVEKLLHQLASKQTIVVNVYDTTNASAPINMYGPDVTDTGLLRVSNLDFGDPSRKHEMHCRFKQKPPVPWTAINASIGVVVITLLVGHIFHAAINRIAQVENDYHEMMELKARAEAADVAKSQFLATVSHEIRTPMNGVLGMLQMLMDTELDAAQLDYAQTAHNSGKDLISLINDVLDQAKIESGRLEPEFVPFHLHDVLDNVLSLFSSKANQKGIELAIYVSDRVPEVVIGDPGRFRQIITNLVGNSIKFTQDKGHIFVSVHLADDVRSKVDVKDKVLEKSLNSVQHKSDKVYNTLSGFPVVDRWKSWENFKMLDNTNTMEQLGRIKLLVTVEDTGVGIPLEAQVRIFTPFMQADSSTSRTYGGTGIGLSISRCLVELMGGEIGFVSEPGTGSTFSFTVTFTEGER*********YVPDVSEFRGLRALVIDDKSIRAEVTRYHLQRLEMAVHVANSMQLACSYLSDTCSTSVLPQLALVLIDKDVWDKEIGLVLHYMLKQQRRKGGLEISRNLPKIFLLATSISETDRDELKSDGIVTLLTKPLRLSVLIGCFQ*********************LKGKQILVVDDNMVNRRVAEGALKKHGAIVTCVDCGRAAVDKLTPPHNFDACFMDLQMPEMDGFQATWQIRHLENEINEQIASGESSAEMFGNVGLWHVPILAMTADVIQASNEQCMKCGMDDYVSKPFEDEQLYTAVARFFMS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTMAMTCKLCGSSSSRLSASSKLKKASEPLQGPDRVNRRSTLAFLWLLGFVIVGSICFLLSCDGGAFVGNEEEEGRMSCEKKAQIFLQHSNVSHNQLHALATLFSESDQIASLKCTREPGSGMLLHNGITCAMKVPYSKKQEFQKQSIWLAEDVKQMDQCPVEDVNVSWKLDHSVLKNISHARTWSNCTRDHFKILSFCLFKGCWWFICGMVVICIIVSLLFKSRRNHKHKHDQLQPVSQQRQMILQQKQQQQTPHPPRSAGKWRMKILVVFVLLGIAISVWLFWLLKEKMHLRRKETLASMCDERARMLQDQFNVSMNHVHALAILVSTFHHRKHPSAVDQKTFGEYTERTAFERPLTSGVAYALKVLHSEREQFEKQHGWKIKKMETEDQTLVQDCTPENLDPAPVQDEYAPVIFSQETVSHIVSIDMMSGKEDRENILRARASGKGVLTPPFKLLKSNHLGVVLTFAVYNTDLPQDATPEQRIEATLGYLGASYDVPSLVEKLLHQLASKQTIVVNVYDTTNASAPINMYGPDVTDTGLLRVSNLDFGDPSRKHEMHCRFKQKPPVPWTAINASIGVVVITLLVGHIFHAAINRxxxxxxxxxxxxxxxxxxxxxDVAKSQFLATVSHEIRTPMNGVLGMLQMLMDTELDAAQLDYAQTAHNSGKDLISLINDVLDQAKIESGRLEPEFVPFHLHDVLDNVLSLFSSKANQKGIELAIYVSDRVPEVVIGDPGRFRQIITNLVGNSIKFTQDKGHIFVSVHLADDVRSKVDVKDKVLEKSLNSVQHKSDKVYNTLSGFPVVDRWKSWENFKMLDNTNTMEQLGRIKLLVTVEDTGVGIPLEAQVRIFTPFMQADSSTSRTYGGTGIGLSISRCLVELMGGEIGFVSEPGTGSTFSFTVTFTEGERNSLDPKWQQYVPDVSEFRGLRALVIDDKSIRAEVTRYHLQRLEMAVHVANSMQLACSYLSDTCSTSVLPQLALVLIDKDVWDKEIGLVLHYMLKQQRRKGGLEISRNLPKIFLLATSISETDRDELKSDGIVTLLTKPLRLSVLIGCFQEDPESSKKLQQKRKKPSLGHLLKGKQILVVDDNMVNRRVAEGALKKHGAIVTCVDCGRAAVDKLTPPHNFDACFMDLQMPEMDGFQATWQIRHLENEINEQIASGESSAEMFGNVGLWHVPILAMTADVIQASNEQCMKCGMDDYVSKPFEDEQLYTAVARFFMSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histidine kinase 2 Cytokinins (CK) receptor related to bacterial two-component regulators. Functions as a histidine kinase and transmits the stress signal to a downstream MAPK cascade. This protein undergoes an ATP-dependent autophosphorylation at a conserved histidine residue in the kinase core, and a phosphoryl group is then transferred to a conserved aspartate residue in the receiver domain. In the presence of cytokinin, feed phosphate to phosphorelay-integrating histidine phosphotransfer protein (HPt) and activates subsequent cascade. Involved in meristems establishment in seedlings. Redundant negative regulator of drought and salt stress responses and abscisic acid (ABA) signaling. Together with AHK3, plays a negative regulatory role in cold stress signaling via inhibition of ABA response, occurring independently of the cold acclimation pathway. Redundant positive regulator of cytokinin signaling that regulates many development process including seed germination, cell division, seed size, chlorophyll retention during leaf senescence, root repression and shoot promotion. Involved in alkamides (e.g. N-isobutyl decanamide) and N-acylethanolamides (NAE) signaling that control meristematic activity and differentiation processes during plant development. Contributes to vascular bundle formation and secondary growth in a cytokinin-dependent manner, probably by promoting the maintenance of mitotic activity and/or identity of procambial cells. Together with AHK4, required for growth and reproduction promotion stimulated by the endophytic fungus Piriformospora indica in a trans-zeatin-dependent manner. Required by the cytokinin-dependent flower development regulation pathway.probableQ9C5U2

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.13.-Protein-histidine kinases.probable
2.7.13.3Histidine kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T4J, chain A
Confidence level:very confident
Coverage over the Query: 293-391,405-565
View the alignment between query and template
View the model in PyMOL
Template: 4EW8, chain A
Confidence level:very confident
Coverage over the Query: 625-777
View the alignment between query and template
View the model in PyMOL
Template: 3MM4, chain A
Confidence level:confident
Coverage over the Query: 1075-1156,1175-1219
View the alignment between query and template
View the model in PyMOL
Template: 2AYX, chain A
Confidence level:confident
Coverage over the Query: 922-962,976-988,1004-1021,1033-1153,1176-1219
View the alignment between query and template
View the model in PyMOL
Template: 3D36, chain A
Confidence level:confident
Coverage over the Query: 627-777,797-802,822-828,850-903
View the alignment between query and template
View the model in PyMOL
Template: 2AYX, chain A
Confidence level:confident
Coverage over the Query: 922-962,976-988,1004-1021,1033-1153,1176-1219
View the alignment between query and template
View the model in PyMOL
Template: 1Y8O, chain A
Confidence level:probable
Coverage over the Query: 563-682,703-776,804-817,837-913
View the alignment between query and template
View the model in PyMOL
Template: 1W25, chain A
Confidence level:probable
Coverage over the Query: 929-1152,1173-1216
View the alignment between query and template
View the model in PyMOL