Citrus Sinensis ID: 000926
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1222 | ||||||
| 297745622 | 1477 | unnamed protein product [Vitis vinifera] | 0.506 | 0.419 | 0.608 | 0.0 | |
| 449455738 | 1463 | PREDICTED: uncharacterized protein LOC10 | 0.493 | 0.412 | 0.546 | 1e-168 | |
| 255539360 | 1553 | conserved hypothetical protein [Ricinus | 0.502 | 0.395 | 0.552 | 1e-167 | |
| 449528207 | 909 | PREDICTED: uncharacterized LOC101219495 | 0.456 | 0.613 | 0.540 | 1e-145 | |
| 356577005 | 1501 | PREDICTED: uncharacterized protein LOC10 | 0.472 | 0.384 | 0.532 | 1e-145 | |
| 356523390 | 1296 | PREDICTED: uncharacterized protein LOC10 | 0.472 | 0.445 | 0.534 | 1e-138 | |
| 297845076 | 1186 | hypothetical protein ARALYDRAFT_472337 [ | 0.481 | 0.495 | 0.508 | 1e-131 | |
| 357438817 | 1290 | hypothetical protein MTR_1g035040 [Medic | 0.475 | 0.450 | 0.486 | 1e-130 | |
| 186478714 | 1364 | uncharacterized protein [Arabidopsis tha | 0.471 | 0.422 | 0.510 | 1e-130 | |
| 224088206 | 485 | predicted protein [Populus trichocarpa] | 0.372 | 0.938 | 0.549 | 1e-123 |
| >gi|297745622|emb|CBI40787.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 662 bits (1709), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 387/636 (60%), Positives = 476/636 (74%), Gaps = 17/636 (2%)
Query: 595 NRGIQLTGGEDGDR-TFQDVEGIERSDRCETQTSTPEGSTVDASESRNIGVEVVKQPFYF 653
N G Q+T + D+ T Q+ RS +S+ E + DA +S+N+ VEV K+PFYF
Sbjct: 851 NEGDQITSVDSDDKLTCQEA----RSVLGNGTSSSLEFLSTDALDSQNVPVEVGKRPFYF 906
Query: 654 LVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDERS 713
L++VPRYDDE +RE+IK AQ +VDEKT+SRDAIR +IQ RA KEY+EK EAA+S+ER+
Sbjct: 907 LIRVPRYDDEKVREEIKLAQLQVDEKTKSRDAIRSEIQIKRAVCKEYSEKFEAALSEERA 966
Query: 714 ARESLKSKRQEIDSVQSRINMMKNAISVDDIDGSIRNMEHRIAHETLPLKEEKQIIREIK 773
AR+ LKSK QE+DSVQS IN +KNA+SV DIDG IR+MEH I HETLPLKEEKQ+IR+IK
Sbjct: 967 ARDLLKSKFQEMDSVQSVINRVKNAMSVKDIDGRIRHMEHAIEHETLPLKEEKQLIRDIK 1026
Query: 774 QLKQRREQISSSIGEHDEVQLAFDQKDQIEEKMKFLRKEADSLRENVIKAEAATQAVKKL 833
QL+ REQ+SS++G +EVQ A DQK Q+EE+ K LR+E DSL+ V KAE T+A KK
Sbjct: 1027 QLRNVREQLSSNMGRQEEVQQALDQKSQVEEQSKILREEVDSLKYKVQKAEVITKAAKKK 1086
Query: 834 HREESEKLKRLLGQFKAADEIRQEAYKHWQSLKKQAYDKNQHFWKYKDDTKQANDLASKG 893
+ +E+EKL L +FKAAD+IRQEAY H QSL+K+ +KN++F YKD+ K AND AS G
Sbjct: 1087 YYDENEKLNELQARFKAADDIRQEAYTHLQSLRKKLSEKNKYFRMYKDNLKAANDYASAG 1146
Query: 894 DREALQHLCVNQVERVLELWNNNDEFRKEYVNSNIRSTLRRLKTLDGRSLGPDEEAPLIR 953
D+EALQ LCVN+VE ++ELWNNNDEFRKEYV N RSTLRRL+TLDGRSLGPDEE P+I
Sbjct: 1147 DKEALQRLCVNEVETIMELWNNNDEFRKEYVRCNTRSTLRRLRTLDGRSLGPDEEPPVIP 1206
Query: 954 PFLNDRVAKNI-------SLTQISALEREKTEQVVPIKSEKVDDKPFPEVREQGDQIAKF 1006
FLN+R+ +++ S+ +S +EREK Q+VP +E DDK V Q ++ AK
Sbjct: 1207 NFLNERIGRSLFAPTKDSSVLIVSTVEREK--QMVPATAESADDKSVVNVTNQKNRTAKN 1264
Query: 1007 KKPEKPSRAENVSTTVSGRDDEIEEAKEEVPKLTKEEEEMARKAEEKRKEEATAKLREQR 1066
K P K S VS T+SGR DEIEE KEE K TKEEEE+ARKAEE RKEE AKL+EQR
Sbjct: 1265 KNPTK-SATGAVSATISGR-DEIEETKEE-HKQTKEEEELARKAEELRKEEEAAKLKEQR 1321
Query: 1067 RLEEKAKAQEALERKKRIAEKAQTRAALRAQKEAEQKEKEREKRARKKEKRKAAAAEDTA 1126
RLEEKAKA+EALERKKR AEKAQ RA LRAQKEAEQK++EREK+ARKKE+RK+++AE T
Sbjct: 1322 RLEEKAKAKEALERKKRNAEKAQARAELRAQKEAEQKQREREKKARKKERRKSSSAEGTE 1381
Query: 1127 ITNEEEYTQSSETPLEVPRTPELRDKPSTATKKPKKASQFTKQAKAKSIPLPLRNRGKRR 1186
NE E SSET E E+ +KP TKKP K+SQFTKQ K+KSIP PLR+RGKRR
Sbjct: 1382 GCNEAESAPSSETSFETTLDSEIIEKPRAITKKPHKSSQFTKQPKSKSIPPPLRSRGKRR 1441
Query: 1187 VPSWMWVLIIALVVFALFLLGNSSFSFKFGFGGSAF 1222
+ SWMWV++IAL+V ALFLLGNS FS+ G F
Sbjct: 1442 IQSWMWVVLIALLVLALFLLGNSGFSYGLGLRNFGF 1477
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449455738|ref|XP_004145608.1| PREDICTED: uncharacterized protein LOC101219495 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255539360|ref|XP_002510745.1| conserved hypothetical protein [Ricinus communis] gi|223551446|gb|EEF52932.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449528207|ref|XP_004171097.1| PREDICTED: uncharacterized LOC101219495 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356577005|ref|XP_003556620.1| PREDICTED: uncharacterized protein LOC100798700 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356523390|ref|XP_003530323.1| PREDICTED: uncharacterized protein LOC100820077 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297845076|ref|XP_002890419.1| hypothetical protein ARALYDRAFT_472337 [Arabidopsis lyrata subsp. lyrata] gi|297336261|gb|EFH66678.1| hypothetical protein ARALYDRAFT_472337 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|357438817|ref|XP_003589685.1| hypothetical protein MTR_1g035040 [Medicago truncatula] gi|355478733|gb|AES59936.1| hypothetical protein MTR_1g035040 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|186478714|ref|NP_173521.2| uncharacterized protein [Arabidopsis thaliana] gi|332191928|gb|AEE30049.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224088206|ref|XP_002308370.1| predicted protein [Populus trichocarpa] gi|222854346|gb|EEE91893.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1222 | ||||||
| TAIR|locus:2037365 | 1364 | AT1G20970 "AT1G20970" [Arabido | 0.361 | 0.324 | 0.480 | 5.1e-120 | |
| TAIR|locus:2124019 | 612 | PPI1 "proton pump interactor 1 | 0.359 | 0.717 | 0.237 | 3.8e-27 | |
| UNIPROTKB|Q8IIG7 | 1070 | PF11_0207 "Uncharacterized pro | 0.260 | 0.297 | 0.194 | 6.7e-12 | |
| TAIR|locus:2087115 | 589 | PPI2 "proton pump interactor 2 | 0.255 | 0.529 | 0.215 | 7.3e-12 | |
| TAIR|locus:504955937 | 734 | AT2G22795 "AT2G22795" [Arabido | 0.496 | 0.826 | 0.217 | 1.1e-11 | |
| DICTYBASE|DDB_G0271058 | 1528 | vilC "villin-like protein C" [ | 0.347 | 0.278 | 0.207 | 8.4e-09 | |
| TAIR|locus:2098443 | 2081 | AT3G28770 "AT3G28770" [Arabido | 0.646 | 0.379 | 0.195 | 1.2e-08 | |
| ZFIN|ZDB-GENE-060503-506 | 1041 | si:ch211-250g4.3 "si:ch211-250 | 0.290 | 0.341 | 0.229 | 1.8e-08 | |
| UNIPROTKB|Q9X0R4 | 1170 | smc "Chromosome partition prot | 0.279 | 0.292 | 0.225 | 1.9e-08 | |
| UNIPROTKB|P82094 | 1093 | TMF1 "TATA element modulatory | 0.249 | 0.279 | 0.236 | 1.9e-08 |
| TAIR|locus:2037365 AT1G20970 "AT1G20970" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1000 (357.1 bits), Expect = 5.1e-120, Sum P(3) = 5.1e-120
Identities = 221/460 (48%), Positives = 309/460 (67%)
Query: 587 KTCPEVKENRGIQLT-----GGED--GDRTFQDVEG--IERSDRCETQTSTPEGSTVDAS 637
KTC + E++ + T G +D + ++ EG ++R+D + ST E S +DAS
Sbjct: 713 KTCAQDLESKVVTSTDTIHTGAKDCVDSQPAENKEGNVVDRTD--DKVASTGEVSVLDAS 770
Query: 638 ESRNIGVEVVKQPFYFLVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASY 697
E + E+ K+PFYFL +VPRYDDE L EQ+K A+ +VD+KT++RDA+R DIQ IRA
Sbjct: 771 EGLTVAAEIEKRPFYFLPRVPRYDDEKLAEQLKHAEEQVDQKTQNRDALRADIQKIRAIC 830
Query: 698 KEYAEKLEAAISDERSARESLKSKRQEIDSVQSRINMMKNAISVDDIDGSIRNMEHRIAH 757
K+Y +A +++ERSAR+++ SKRQEI+++QS I+ +K+A SVDDID +RNMEH + H
Sbjct: 831 KDYDISYKAVMAEERSARKAMHSKRQEIEALQSMISRVKSAASVDDIDSRVRNMEHTMQH 890
Query: 758 ETLPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQLAFDQKDQIEEKMKFLRKEADSLR 817
TL L EEK +REIKQLKQ REQISSS+G DEV+ A D+K++ EE++K LRKE D+LR
Sbjct: 891 TTLSLNEEKGFMREIKQLKQLREQISSSMGTKDEVKQALDEKEKTEERLKVLRKELDALR 950
Query: 818 ENVIKAEAATQAVKKLHREESEKLKRLLGQFKAADEIRQEAYKHWQSLKKQAYDKNQHFW 877
++ KAE T+A KK E E +L QF+AAD +RQEA+ H Q LKKQ +KN++F+
Sbjct: 951 NDLSKAEEITKAAKKKCDGEWEAQSKLQEQFRAADAVRQEAFVHLQDLKKQQREKNKYFF 1010
Query: 878 KYKDDTKQANDLASKGDREALQHLCVNQVERVLELWNNNDEFRKEYVNSNIRSTLRRLKT 937
KY+D+++ A+++A K DR ALQ LC +QVE + +WNN+DEFRK YV SN RST RRL T
Sbjct: 1011 KYRDNSRAASEMALKKDRAALQSLCSDQVENFMNMWNNDDEFRKYYVKSNTRSTFRRLGT 1070
Query: 938 LDGRSLGPDEEAPLIR--PFLNDRVAKNISLTQISALEREKTEQVVPIKSEKVDD--KPF 993
LDGRSLGPDEE P I P + + + A+ +K E+VV + KV++ K
Sbjct: 1071 LDGRSLGPDEEPPRITYAPRTDKLRTSSDRAEKHEAVPAQK-EKVVKFEGSKVENNGKEV 1129
Query: 994 PEVREQGDQIAKFKKPEKPSRAENVSTT-VSGRDDEIEEA 1032
+ EQ Q K KK KP + ++ T VSG++ EIE++
Sbjct: 1130 AKPTEQKSQTTKSKKAVKPDQPPSIVTELVSGKE-EIEKS 1168
|
|
| TAIR|locus:2124019 PPI1 "proton pump interactor 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IIG7 PF11_0207 "Uncharacterized protein PF11_0207" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2087115 PPI2 "proton pump interactor 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504955937 AT2G22795 "AT2G22795" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0271058 vilC "villin-like protein C" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098443 AT3G28770 "AT3G28770" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060503-506 si:ch211-250g4.3 "si:ch211-250g4.3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9X0R4 smc "Chromosome partition protein Smc" [Thermotoga maritima MSB8 (taxid:243274)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P82094 TMF1 "TATA element modulatory factor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00002957001 | SubName- Full=Chromosome chr18 scaffold_137, whole genome shotgun sequence; (662 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1222 | |||
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-12 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-10 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-08 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-07 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-07 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 6e-07 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 1e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-06 | |
| COG1340 | 294 | COG1340, COG1340, Uncharacterized archaeal coiled- | 3e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-06 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 7e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 8e-06 | |
| PRK07735 | 430 | PRK07735, PRK07735, NADH dehydrogenase subunit C; | 8e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-05 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 2e-05 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 3e-05 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 3e-05 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 4e-05 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 4e-05 | |
| pfam10147 | 217 | pfam10147, CR6_interact, Growth arrest and DNA-dam | 4e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-05 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 6e-05 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 6e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 7e-05 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 7e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 8e-05 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 8e-05 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 8e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 1e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| PRK07735 | 430 | PRK07735, PRK07735, NADH dehydrogenase subunit C; | 2e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 2e-04 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 2e-04 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 2e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-04 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 3e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 3e-04 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 3e-04 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-04 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 4e-04 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 5e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 6e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 7e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 8e-04 | |
| pfam04502 | 321 | pfam04502, DUF572, Family of unknown function (DUF | 8e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 8e-04 | |
| pfam09726 | 680 | pfam09726, Macoilin, Transmembrane protein | 9e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.001 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 0.001 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 0.001 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 0.001 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.001 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 0.001 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 0.001 | |
| PRK12472 | 508 | PRK12472, PRK12472, hypothetical protein; Provisio | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.002 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.002 | |
| COG2268 | 548 | COG2268, COG2268, Uncharacterized protein conserve | 0.002 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 0.002 | |
| PLN02316 | 1036 | PLN02316, PLN02316, synthase/transferase | 0.002 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 0.003 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.003 | |
| TIGR02223 | 298 | TIGR02223, ftsN, cell division protein FtsN | 0.003 | |
| COG1293 | 564 | COG1293, COG1293, Predicted RNA-binding protein ho | 0.003 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 0.003 | |
| COG5281 | 833 | COG5281, COG5281, Phage-related minor tail protein | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.004 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 0.004 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.004 | |
| PLN03086 | 567 | PLN03086, PLN03086, PRLI-interacting factor K; Pro | 0.004 |
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
Score = 70.9 bits (173), Expect = 3e-12
Identities = 105/503 (20%), Positives = 216/503 (42%), Gaps = 44/503 (8%)
Query: 663 ENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDERSARESLKSKR 722
+ +++ + A+ K D + + + + +A + A++ EAA +A + + +
Sbjct: 1318 DEAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEAEAAADEAEAAEEKAEAAEKKKEEAK 1377
Query: 723 QEIDSVQSRINMMKNAISVDDIDGSIRNMEHRIAHETLPLKEEKQIIREIKQLKQRREQI 782
++ D+ + + K A +E+K+ E+K+ +++
Sbjct: 1378 KKADAAKKKAEEKKKADEAKK-----------------KAEEDKKKADELKKAAAAKKKA 1420
Query: 783 SSSIGEHDEVQLAFDQKDQIEEKMKFLRKEADSLRENVIKAEAATQAVKKLH-REESEKL 841
+ + +E + A + K + EE K+AD ++ +A+ A +A KK +++++
Sbjct: 1421 DEAKKKAEEKKKADEAKKKAEEA-----KKADEAKKKAEEAKKAEEAKKKAEEAKKADEA 1475
Query: 842 KRLLGQFKAADEIR---QEAYKHWQSLKKQAYDKNQHFWKYKDDTKQANDLASKGD--RE 896
K+ + K ADE + +EA K KK A K + K + + D A K + ++
Sbjct: 1476 KKKAEEAKKADEAKKKAEEAKKKADEAKKAAEAKKKADEAKKAEEAKKADEAKKAEEAKK 1535
Query: 897 ALQHLCVNQVERVLELWNNNDEFRKEYVNSNIRSTLRRLKTLDGRSLGPDEEAPLIRPFL 956
A + + ++ EL +E +K ++ + +L EEA
Sbjct: 1536 ADEAKKAEEKKKADEL-KKAEELKKAEEKKKAEEA-KKAEEDKNMALRKAEEAKKAEEAR 1593
Query: 957 NDRVAKNISLTQISALEREKTEQVVPIKSEKVDDKPFPEVREQGDQIAKFKKPEKPSRAE 1016
+ V K + E K + IK+E++ K E +++ +Q+ K K+ E+ +AE
Sbjct: 1594 IEEVMKLYEEEKKMKAEEAKKAEEAKIKAEEL--KKAEEEKKKVEQLKK-KEAEEKKKAE 1650
Query: 1017 NVSTTVSGRDDEIEEAKEEVPKLTKEEEEMARKAEEKRKEEATAKLREQRRLEEKAKAQE 1076
+ EE K + + K+ EE +KAEE +K E K + +E +A++
Sbjct: 1651 ELKK-------AEEENKIKAAEEAKKAEEDKKKAEEAKKAEEDEKKAAEALKKEAEEAKK 1703
Query: 1077 ALERKKRIAEKAQTRAALRAQKEAEQKEKEREKRARKKEKRKAAAAEDTAITNEEEYTQS 1136
A E KK+ AE+ + L+ +E + + E K+ +++K+KA A+ +EEE +
Sbjct: 1704 AEELKKKEAEEKKKAEELKKAEEENKIKAEEAKKEAEEDKKKAEEAK----KDEEEKKKI 1759
Query: 1137 SETPLEVPRTPELRDKPSTATKK 1159
+ E + E K A +
Sbjct: 1760 AHLKKEEEKKAEEIRKEKEAVIE 1782
|
Length = 2084 |
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|220600 pfam10147, CR6_interact, Growth arrest and DNA-damage-inducible proteins-interacting protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|218115 pfam04502, DUF572, Family of unknown function (DUF572) | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|237110 PRK12472, PRK12472, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|215180 PLN02316, PLN02316, synthase/transferase | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233787 TIGR02223, ftsN, cell division protein FtsN | Back alignment and domain information |
|---|
| >gnl|CDD|224212 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|227606 COG5281, COG5281, Phage-related minor tail protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|178635 PLN03086, PLN03086, PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1222 | |||
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 99.75 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 98.97 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.37 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.33 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.3 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.27 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.2 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.2 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.2 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.18 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.18 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.17 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.14 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.14 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.07 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.03 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.03 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.02 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.96 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 97.92 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 97.86 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.84 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.82 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 97.79 | |
| PTZ00121 | 2084 | MAEBL; Provisional | 97.67 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.63 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 97.62 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 97.6 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 97.59 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.58 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 97.54 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.5 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.5 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 97.5 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 97.48 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.46 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 97.41 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.35 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 97.34 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.34 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.3 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 97.27 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.26 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.26 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.25 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.15 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.14 | |
| PTZ00121 | 2084 | MAEBL; Provisional | 97.1 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.03 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.01 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.99 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 96.93 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 96.89 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 96.89 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.88 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 96.86 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 96.85 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 96.84 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.82 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 96.82 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 96.81 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.81 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 96.81 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 96.78 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.72 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 96.68 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 96.68 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 96.65 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 96.62 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.61 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 96.6 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 96.55 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 96.55 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 96.54 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 96.54 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.5 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 96.42 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 96.39 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.39 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 96.39 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.36 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.34 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 96.32 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.3 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 96.29 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 96.25 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 96.13 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.11 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 96.1 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 96.05 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 95.93 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 95.91 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 95.9 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 95.82 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 95.78 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 95.72 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 95.59 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 95.58 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 95.58 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 95.57 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 95.5 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 95.4 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 95.36 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 95.27 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 95.06 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 94.83 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 94.77 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 94.76 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 94.73 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 94.72 | |
| PF13514 | 1111 | AAA_27: AAA domain | 94.66 | |
| PF12252 | 1439 | SidE: Dot/Icm substrate protein; InterPro: IPR0210 | 94.64 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 94.6 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 94.55 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 94.44 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 94.31 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 94.27 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 93.97 | |
| PF15450 | 531 | DUF4631: Domain of unknown function (DUF4631) | 93.89 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 93.88 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 93.7 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 93.66 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 93.55 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 93.46 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 93.41 | |
| PF13166 | 712 | AAA_13: AAA domain | 93.37 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 93.35 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 93.34 | |
| PF11600 | 216 | CAF-1_p150: Chromatin assembly factor 1 complex p1 | 93.3 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 93.15 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 93.14 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 93.1 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 93.03 | |
| PF13166 | 712 | AAA_13: AAA domain | 93.0 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 92.99 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 92.96 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 92.88 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 92.79 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 92.7 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 92.63 | |
| KOG2072 | 988 | consensus Translation initiation factor 3, subunit | 92.55 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 92.47 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 92.46 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 92.33 | |
| KOG1850 | 391 | consensus Myosin-like coiled-coil protein [Cytoske | 92.29 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 92.24 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 92.14 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 92.12 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 91.75 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 91.7 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 91.7 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 91.61 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 91.49 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 91.42 | |
| PRK00247 | 429 | putative inner membrane protein translocase compon | 91.35 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 91.33 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 91.22 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 91.1 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 91.06 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 90.83 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 90.78 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 90.58 | |
| KOG4364 | 811 | consensus Chromatin assembly factor-I [Chromatin s | 90.5 | |
| PF03999 | 619 | MAP65_ASE1: Microtubule associated protein (MAP65/ | 90.27 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 89.98 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 89.91 | |
| cd08915 | 342 | V_Alix_like Protein-interacting V-domain of mammal | 89.72 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 89.7 | |
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 89.66 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 89.64 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 89.64 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 89.55 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 89.5 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 89.29 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 89.17 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 89.06 | |
| PF13949 | 296 | ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HI | 88.72 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 88.61 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 88.57 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 88.57 | |
| PF13514 | 1111 | AAA_27: AAA domain | 88.54 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 88.44 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 88.27 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 88.15 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 88.14 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 88.04 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 87.81 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 87.58 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 87.55 | |
| KOG1144 | 1064 | consensus Translation initiation factor 5B (eIF-5B | 87.45 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 87.2 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 86.88 | |
| PRK09510 | 387 | tolA cell envelope integrity inner membrane protei | 86.87 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 86.49 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 86.24 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 86.16 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 86.07 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 86.04 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 85.83 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 85.76 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 85.56 | |
| PRK00247 | 429 | putative inner membrane protein translocase compon | 85.4 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 85.39 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 85.21 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 85.0 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 84.68 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 84.44 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 84.24 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 84.16 | |
| PF13800 | 96 | Sigma_reg_N: Sigma factor regulator N-terminal | 83.95 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 83.76 | |
| PF07946 | 321 | DUF1682: Protein of unknown function (DUF1682); In | 83.73 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 83.59 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 83.56 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 83.49 | |
| KOG3054 | 299 | consensus Uncharacterized conserved protein [Funct | 83.34 | |
| cd09234 | 337 | V_HD-PTP_like Protein-interacting V-domain of mamm | 83.32 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 83.28 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 82.96 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 82.89 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 82.74 | |
| KOG4438 | 446 | consensus Centromere-associated protein NUF2 [Cell | 82.68 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 82.63 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 82.08 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 82.0 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 81.93 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 81.91 | |
| cd07651 | 236 | F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology | 81.83 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 81.74 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 81.63 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 81.43 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 81.34 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 81.19 | |
| cd09235 | 339 | V_Alix Middle V-domain of mammalian Alix and relat | 80.96 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 80.82 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 80.54 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 80.54 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 80.5 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 80.23 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 80.16 | |
| KOG1144 | 1064 | consensus Translation initiation factor 5B (eIF-5B | 80.05 |
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
Probab=99.75 E-value=1.8e-15 Score=164.56 Aligned_cols=208 Identities=17% Similarity=0.307 Sum_probs=145.7
Q ss_pred hHHHHHHHHHHHhHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhc-----
Q 000926 662 DENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDERSARESLKSKRQEIDSVQSRINMMK----- 736 (1222)
Q Consensus 662 DEeLKAKIdeLqKEIeKLnq~RdaI~eELkalRaERdELiEQLKeLReE~KqlReer~EKIKEIk~LQeaLnKLR----- 736 (1222)
...+..++..+...+..+++.|+.++.+++.++++|++|+.++++++++.++++..+++.++++..++...+.++
T Consensus 8 ~~E~e~K~~~lk~~~~e~~ekR~El~~~~~~~~ekRdeln~kvrE~~e~~~elr~~rdeineev~elK~kR~ein~kl~e 87 (294)
T COG1340 8 LDELELKRKQLKEEIEELKEKRDELRKEASELAEKRDELNAKVRELREKAQELREERDEINEEVQELKEKRDEINAKLQE 87 (294)
T ss_pred hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 456777777888899999999999999999999999999999999888887777776666666655544322110
Q ss_pred -----------------cCCCHHHHHHHHHHHHHHhhcCCCChHHHHHHHHHHHHHHHHHHHhhhhccchhHHHHHHhHH
Q 000926 737 -----------------NAISVDDIDGSIRNMEHRIAHETLPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQLAFDQK 799 (1222)
Q Consensus 737 -----------------nAkSVEEIDarIa~LE~RIQTgSLSLvEEKKLLKEIKQLKKsRKkViAnAa~rAKIQESidQK 799 (1222)
...++..|.+.|.+|||.+||.+||+.+|+++|++|++|++...... ..
T Consensus 88 L~~~~~~l~e~~~~~~~~~~~~~~ler~i~~Le~~~~T~~L~~e~E~~lvq~I~~L~k~le~~~--------------k~ 153 (294)
T COG1340 88 LRKEYRELKEKRNEFNLGGRSIKSLEREIERLEKKQQTSVLTPEEERELVQKIKELRKELEDAK--------------KA 153 (294)
T ss_pred HHHHHHHHHHHhhhhhccCCCHHHHHHHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHHHH--------------HH
Confidence 13699999999999999999999999999999999999998865441 12
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 000926 800 DQIEEKMKFLRKEADSLRENVIKAEAATQAVKKLHREESEKLKRLLGQFKAADEIRQEAYKHWQSLKKQAYDKNQHFWKY 879 (1222)
Q Consensus 800 EaIqEQIKaLKKEIDELRkKLkkLeaElKELsKK~DEIkaEI~ELQeElkAL~EKRDEAYeeIkeLRKERDEkNkeFYqn 879 (1222)
...+.+++.|.+++++++.+...++.++.+|..+.++++.+|..+..+.+.++...|++-+.+-.+++..++.+..|-+.
T Consensus 154 ~e~~~~~~el~aei~~lk~~~~e~~eki~~la~eaqe~he~m~k~~~~~De~Rkeade~he~~ve~~~~~~e~~ee~~~~ 233 (294)
T COG1340 154 LEENEKLKELKAEIDELKKKAREIHEKIQELANEAQEYHEEMIKLFEEADELRKEADELHEEFVELSKKIDELHEEFRNL 233 (294)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHH
Confidence 23455666777777777776666666555555555555555555555555555555555555444444444444444444
Q ss_pred HHHH
Q 000926 880 KDDT 883 (1222)
Q Consensus 880 Rr~i 883 (1222)
+..+
T Consensus 234 ~~el 237 (294)
T COG1340 234 QNEL 237 (294)
T ss_pred HHHH
Confidence 3333
|
|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF12252 SidE: Dot/Icm substrate protein; InterPro: IPR021014 This entry represents bacterial proteins that are typically between 397 and 1543 amino acids in length including SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF15450 DUF4631: Domain of unknown function (DUF4631) | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF11600 CAF-1_p150: Chromatin assembly factor 1 complex p150 subunit, N-terminal; InterPro: IPR021644 P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [] | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK00247 putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF03999 MAP65_ASE1: Microtubule associated protein (MAP65/ASE1 family); InterPro: IPR007145 This is a family of microtubule associated proteins | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd08915 V_Alix_like Protein-interacting V-domain of mammalian Alix and related domains | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF13949 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HIV ; PDB: 2XS1_A 2XS8_A 2R03_A 2R02_A 2OEX_B 2OEV_A 2OJQ_A 2R05_A | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK00247 putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF13800 Sigma_reg_N: Sigma factor regulator N-terminal | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF07946 DUF1682: Protein of unknown function (DUF1682); InterPro: IPR012879 The members of this family are all hypothetical eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >KOG3054 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd09234 V_HD-PTP_like Protein-interacting V-domain of mammalian His-Domain type N23 protein tyrosine phosphatase and related domains | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >cd09235 V_Alix Middle V-domain of mammalian Alix and related domains are dimerization and protein interaction modules | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1222 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-10 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 6e-09 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 4e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-04 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 3e-07 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 1e-06 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 8e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-05 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 5e-05 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 7e-05 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 6e-04 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 9e-05 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 4e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 66.4 bits (161), Expect = 5e-11
Identities = 51/396 (12%), Positives = 110/396 (27%), Gaps = 111/396 (28%)
Query: 788 EHDEVQLAFDQKDQIEEKMKFLRKE------ADSLRENVIKAEAATQAVKKLHREESEKL 841
E E Q + KD + D + +++ E +
Sbjct: 10 ETGEHQYQY--KDILSVFEDAFVDNFDCKDVQDMPK-SILSKEEIDHIIMSKDAVS--GT 64
Query: 842 KRLLGQFKAADEIRQEAYKHW-QSLKKQAYDKNQHFW---KYKDDTKQANDLASKGDREA 897
RL + E E + + + + + Y + K + +Q
Sbjct: 65 LRLFWTLLSKQE---EMVQKFVEEVLRINYK-----FLMSPIKTEQRQ---------PSM 107
Query: 898 LQHLCVNQVERVLELWNNNDEFRKEYVN-----SNIRSTLRRLK-----TLDG------- 940
+ + + Q +R L+N+N F K V+ +R L L+ +DG
Sbjct: 108 MTRMYIEQRDR---LYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKT 164
Query: 941 -------R---------------SLGPDEEAPLIRPFLND---RVAKN-ISLTQISALER 974
+L + L ++ N S + S+ +
Sbjct: 165 WVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIK 224
Query: 975 EKTEQVVPIKSEKVDDKPFPE-------VREQGDQIAKFKKPEK---PSRAENVSTTVSG 1024
+ + + KP+ V+ F K +R + V+ +S
Sbjct: 225 LRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKA-WNAFNLSCKILLTTRFKQVTDFLSA 283
Query: 1025 RDDEIEEAKEEVPKLTKEE-EEM-ARKAEEKRK---EEAT-----------AKLREQRRL 1068
LT +E + + + + + + E +R+
Sbjct: 284 ATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLAT 343
Query: 1069 EEKAKAQEALERKKRIAEKAQTRAALRAQKEAEQKE 1104
+ K ++ I E ++L + AE ++
Sbjct: 344 WDNWK-HVNCDKLTTIIE-----SSLNVLEPAEYRK 373
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Length = 503 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1222 | ||||
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 5e-04 | |
| d1vp4a_ | 420 | c.67.1.1 (A:) Putative aminotransferase TM1131 {Th | 0.002 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 0.002 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 0.003 |
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Non-globular all-alpha subunits of globular proteins superfamily: Stathmin family: Stathmin domain: Stathmin 4 species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 39.5 bits (92), Expect = 5e-04
Identities = 15/89 (16%), Positives = 36/89 (40%)
Query: 1030 EEAKEEVPKLTKEEEEMARKAEEKRKEEATAKLREQRRLEEKAKAQEALERKKRIAEKAQ 1089
+ E + +E E + AE++ E + + A+E L +K ++ +
Sbjct: 50 KLEAAEERRKYQEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENR 109
Query: 1090 TRAALRAQKEAEQKEKEREKRARKKEKRK 1118
+ ++K+K E+ + KE ++
Sbjct: 110 EAHLAAMLERLQEKDKHAEEVRKNKELKE 138
|
| >d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Length = 420 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00