Citrus Sinensis ID: 000973

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200-----
MYSKRSGQGDGSVPGPVRTSDRLRRRPKILGRTYLYYNPIRPRKSKTKARTAASQIARMFGPGKRTVRTSNKNSVPLNLRRSTRKRRISVNLEDYTDSSGSEDEDLMRPSYRPLRNRMRNNMSQDELSPSKRKKVVEAKPTPRREGLRPRRSMVATRKQLNLDSGDEQGSSEEKVGQDETENGNESDNDADDGQNEIEGDGEAEAEDEGEGEDEEDGDDEEGEEEQEGRRRYDLRNRAEVRRLSVEEGKQRPRSPRRVLHQGIGTKVGRDVRKGGSRVLKRHRLARAEDSDDSLLVDELDQGPAIPWGRGGSRSGPPWLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTSGIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSEGTGVDHLGPAILHELEKFPVHSLGLPALLSDPSAKTPEEALVHIFGEARRTTPSILYIPQFNLWWENAHEQLRAVLLTLLEELPSHLPILLLGSSSVPLAEVEGDPSTVFPLRSVYQVEKPSTEDRSLFLGRLIEAAVSVVLEGRSKKPQESVSLPELPKVPTVESGPKASELKAKVEAEQHALRRLRMCLRDVCNRMLYDKRFSAFHYPVTDEDAPNYRSIIQNPMDLATLLQRVDSGHYVTCSAFLQDVDLIVTNAKAYNGNDYNGTRIVSRGYELRDAVHGMLSQMDPALVSYCDKIAAQGGPTPLPDDLGGSIFPTTPVVQLGTVTRASARLRNVQPEVNLDQSYEALKRPKKSTDAPHAATVVEDKSRHQESVQQTKSCDDVEANDADTEMLESSCADGNQHDAPREACGLTEGGGSQDVTILCGEVVQEAEPIKQLFVVRTESYGIPQLERLYTRVMKGIFDIKDRDDPKPSILGFLSKFAEDEANF
ccccccccccccccccccccHHHHcccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHHHHHHccccccccEEEEEEcccccccccccccccccccEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEcHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHccccccccccccccEEEEEccccccHHHHHHHHHHHHccccEEEccccccccccccccHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHcccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccc
ccccccccccccccccccccHHHccccccccccEEEccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccEEEEEccccccccccccHHcccccccccccccccccccccccccHHHccccccccccccccccccccHHHHccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccEEcHHcHHHHccccHHccccccccccEEEEccccccccccccccccccccccccccccccccccEccccccccccccccccccccHHHHHHHHccccccccccEEEccccccEEEEEEEcccccccccccccEEEEEEEEcccccccHcccccHHHHHHHHHHHHccccccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHccccccEEEEEEEccHHHHHHHHcHcHHHHHHHHHHHHHccccEEEEccHHHHccccccccccHHHHHHHHHHHHHcHHHHcccEEEEEEccccccccHHHcccccccEEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHcccccHHHHHHHHHHccccHHHHHEEEcccccHHHcccHHHHHHHHHHHHHccccccccHHHHHHcccccccHHccccccccEEEEccccccHHHHHHHHHHHHcccEEEEcccHHHHHHHccccHHHHHHHHHHHHHHHccEEEEEcHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHccccccccEEEEEccccHHHHHHHHHHHHHccccccccccccccHccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEcEHHccccccccccccHHHHHcccccccHHHcccHccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccEEEccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHEcccccccHHHHHHHHHHHHHccccc
myskrsgqgdgsvpgpvrtsdrlrrrpkilgrtylyynpirprksktKARTAASQIARmfgpgkrtvrtsnknsvplnlrrstrkrrisvnledytdssgsededlmrpsyrplrnrmrnnmsqdelspskrkkvveakptprreglrprrsmVATRKQlnldsgdeqgsseekvgqdetengnesdndaddgqneiegdgeaeaedegegedeedgddeegeeeqegrrrydlrNRAEVRRLSveegkqrprsprrvlhqgigtkvgrdvrkggsRVLKRHRlaraedsddsllvdeldqgpaipwgrggsrsgppwlfgglemhgttawglnvaasgwghqgdTLAALTSGiqtagpsskggadiqplqvdesvsfddiGGLSEYIDALKEMvffpllypdffasyhitpprgvllcgppgtgKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAqrnqpsiiffdeidglapvrsskqeqIHNSIVSTLLALMDGLDSRGQVVLIGATnrvdaidgalrrpgrfdrefnfplpgceARAEILDIHtrkwkqppsrelKSELAASCVGYCGADLKALCTEAAIRAFREkypqvytsddkflidvdsvtVEKYHFIEAMStitpaahrgatvhsrplslvVAPCLQRHLQKAMNYIsdifpplgmsselTKLCMLshgsaiplvyrprlllcgsegtgvdhlgpailhelekfpvhslglpallsdpsaktpeEALVHIFGearrttpsilyipqfNLWWENAHEQLRAVLLTLLEElpshlpilllgsssvplaevegdpstvfplrsvyqvekpstedRSLFLGRLIEAAVSVVLEgrskkpqesvslpelpkvptvesgpkaSELKAKVEAEQHALRRLRMCLRDVCNRmlydkrfsafhypvtdedapnyrsiiQNPMDLATLLqrvdsghyvtcSAFLQDVDLIVTNAkayngndyngtrivsRGYELRDAVHGMLSQMDPALVSYCDKiaaqggptplpddlggsifpttpvvqlGTVTRASArlrnvqpevnldqsyealkrpkkstdaphaatvvedksrhqesvqqtkscddveandadTEMLEsscadgnqhdapreacgltegggsqdvTILCGevvqeaepiKQLFVVRtesygipqleRLYTRVMKGIfdikdrddpkpsilgFLSKfaedeanf
myskrsgqgdgsvpgpvrtsdrlrrrpkilgrtylyynpirprksktkaRTAASQiarmfgpgkrtvrtsnknsvplnlrrstrkrrisvnledytdssgsededlmrpsyrplrnrmrnnmsqdelspskrkkvveakptprreglrprrsmvatrkqlnldsgdeqgsseekvgqdetengnesdndaddgqNEIEGdgeaeaedegegedeedgddeegeeeqegrrrydlrnraevrrlsveegkqrprsprrvlhqgigtkvgrdvrkggsrvlkrhrlaraedsddsllvDELDQgpaipwgrggsRSGPPWLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTSGIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIgatnrvdaidgalrrpgrfdrefnfplpgCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFRekypqvytsddkfliDVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSEGTGVDHLGPAILHELEKFPVHSLGLPALLSDPSAKTPEEALVHIFGEARRTTPSILYIPQFNLWWENAHEQLRAVLLTLLEELPSHLPILLLGSSSVPLAEVEGDPSTVFPLRSVYQVEKPSTEDRSLFLGRLIEAAVSVVLegrskkpqesvslpelpkvptvesgpkaselKAKVEAEQHALRRLRMCLRDVCNRMLYDKRFSAFHYPVTDEDAPNYRSIIQNPMDLATLLQRVDSGHYVTCSAFLQDVDLIVTNAkayngndyngtrIVSRGYELRDAVHGMLSQMDPALVSYCDKIAAQGGPTPLPDDLGGSIFPTTPVVQLGTVTRasarlrnvqpevnldqsyealkrpkkstdaPHAATvvedksrhqesvqqtkscddVEANDADTEMLESSCADGNQHDAPREACGLTEGGGSQDVTILCGEVVQEAEPIKqlfvvrtesygipqlerlyTRVMKGIFdikdrddpkpsilgflskfaedeanf
MYSKRSGQGDGSVPGPVRTSDRLRRRPKILGRTYLYYNPIRPRKSKTKARTAASQIARMFGPGKRTVRTSNKNSVPLNLRRSTRKRRISVNLEDYTDSSGSEDEDLMRPSYRPLRNRMRNNMSQDELSPSKRKKVVEAKPTPRREGLRPRRSMVATRKQLNLDSGDEQGSSEEKVGQDETENGNESDNDADDGQNEIegdgeaeaedegegedeedgddeegeeeQEGRRRYDLRNRAEVRRLSVEEGKQRPRSPRRVLHQGIGTKVGRDVRKGGSRVLKRHRLARAedsddsllvdeldQGPAIpwgrggsrsgppwLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTSGIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSEGTGVDHLGPAILHELEKFPVHSLGLPALLSDPSAKTPEEALVHIFGEARRTTPSILYIPQFNLWWENAHeqlravlltlleelpshlPILLLGSSSVPLAEVEGDPSTVFPLRSVYQVEKPSTEDRSLFLGRLIEAAVSVVLEGRSKKPQESVSLPELPKVPTVESGPKASELKAKVEAEQHALRRLRMCLRDVCNRMLYDKRFSAFHYPVTDEDAPNYRSIIQNPMDLATLLQRVDSGHYVTCSAFLQDVDLIVTNAKAYNGNDYNGTRIVSRGYELRDAVHGMLSQMDPALVSYCDKIAAQggptplpddlggSIFPTTPVVQLGTVTRASARLRNVQPEVNLDQSYEALKRPKKSTDAPHAATVVEDKSRHQESVQQTKSCDDVEANDADTEMLESSCADGNQHDAPREACGLTEGGGSQDVTILCGEVVQEAEPIKQLFVVRTESYGIPQLERLYTRVMKGIFDIKDRDDPKPSILGFLSKFAEDEANF
***************************KILGRTYLYYNPI*************************************************************************************************************************************************************************************************************************************************************************************WLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTSG******************VDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVR****EQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWK*********ELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSEGTGVDHLGPAILHELEKFPVHSLGLPALL*********EALVHIFGEARRTTPSILYIPQFNLWWENAHEQLRAVLLTLLEELPSHLPILLLGSSSVPLAEVEGDPSTVFPLRSVYQV*******RSLFLGRLIEAAVSVVL****************************************ALRRLRMCLRDVCNRMLYDKRFSAFHYPVTDEDAPNYRSIIQNPMDLATLLQRVDSGHYVTCSAFLQDVDLIVTNAKAYNGNDYNGTRIVSRGYELRDAVHGMLSQMDPALVSYCDKIAAQGGPTPLPDDLGGSIFPTTPVVQLGTVTRA*****************************************************************************************SQDVTILCGEVVQEAEPIKQLFVVRTESYGIPQLERLYTRVMKGIFDIKD*******ILGF***********
***********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************VDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGL****************STLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKY************DVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTK***********LVYRPRLLLCGSEGTGVDHLGPAILHELEKFPVHSLGLPALLSDPSAKTPEEALVHIFGEARRTTPSILYIPQFNLWWENAHEQLRAVLLTLLEELPSHLPILLLGSSSVPLAEVEGDPSTVFPLRSVYQVEKPSTEDRSLFLGRLIEAAVS*************************************VEAEQHALRRLRMCLRDVCNRMLYDKRFSAFHYPVTDEDAPNYRSIIQNPMDLATLLQRVDSGHYVTCSAFLQDVDLIVTNAKAYNGNDYNGTRIVSRGYELRDAVHGMLSQMDPALVSYCD*******************************************************************************************************************************************PIKQLFVVRTESYGIPQLERLYTRVMKGIFDIKDRDDPKPSILGFLSKFAED****
****************VRTSDRLRRRPKILGRTYLYYNPIRP***********SQIARMFGPGKRTVRTSNKNSVPLNLRRSTRKRRISVNLED************MRPSYRPLRNRMRN********************************MVATRKQLN****************************ADDGQNEIE********************************RYDLRNRAEVRR**************RVLHQGIGTKVGRDVRKGGSRVLKRHRLARAEDSDDSLLVDELDQGPAIPWGRGGSRSGPPWLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTSGIQ**********DIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKW**********ELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSEGTGVDHLGPAILHELEKFPVHSLGLPALLSDPSAKTPEEALVHIFGEARRTTPSILYIPQFNLWWENAHEQLRAVLLTLLEELPSHLPILLLGSSSVPLAEVEGDPSTVFPLRSVYQVEKPSTEDRSLFLGRLIEAAVSVVLEG***********PELPKVPTVESGPKASELKAKVEAEQHALRRLRMCLRDVCNRMLYDKRFSAFHYPVTDEDAPNYRSIIQNPMDLATLLQRVDSGHYVTCSAFLQDVDLIVTNAKAYNGNDYNGTRIVSRGYELRDAVHGMLSQMDPALVSYCDKIAAQGGPTPLPDDLGGSIFPTTPVVQLGTVTRASARLRNVQPEVNLDQSYEAL*****************************************TEMLESSCADGNQHDAPREACGLTEGGGSQDVTILCGEVVQEAEPIKQLFVVRTESYGIPQLERLYTRVMKGIFDIKDRDDPKPSILGFLSKFAEDEANF
********************DRLRRRPKILGRTYLYYNPIR*****************************************TRKRRISVNLEDY***************************************************************************************************************************************RY***NRAEVRRLS*********SPR***********************************DSLLVDELDQGPAIPWGRGGSRSGPPWLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTSGIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSEGTGVDHLGPAILHELEKFPVHSLGLPALLSDPSAKTPEEALVHIFGEARRTTPSILYIPQFNLWWENAHEQLRAVLLTLLEELPSHLPILLLGSSSVPLAEVEGDPSTVFPLRSVYQVEKPSTEDRSLFLGRLIEAAVS********KPQESVSLPELPKVPTVESGPKASELKAKVEAEQHALRRLRMCLRDVCNRMLYDKRFSAFHYPVTDEDAPNYRSIIQNPMDLATLLQRVDSGHYVTCSAFLQDVDLIVTNAKAYNGNDYNGTRIVSRGYELRDAVHGMLSQMDPALVSYCDKIAAQGGPTPLPDDLGGSIFPTTPVVQLGTVTRASARLRNVQPEVNLDQSYEALKR*******************************************************************SQDVTILCGEVVQEAEPIKQLFVVRTESYGIPQLERLYTRVMKGIFDIKDRDDPKPSILGFLSKFAEDEA**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYSKRSGQGDGSVPGPVRTSDRLRRRPKILGRTYLYYNPIRPRKSKTKARTAASQIARMFGPGKRTVRTSNKNSVPLNLRRSTRKRRISVNLEDYTDSSGSEDEDLMRPSYRPLRNRMRNNMSQDELSPSKRKKVVEAKPTPRREGLRPRRSMVATRKQLNLDSGDEQGSSEEKVGQDETENGNESDNDADDGQNEIEGDGEAEAEDEGEGEDEEDGDDEEGEEEQEGRRRYDLRNRAEVRRLSVEEGKQRPRSPRRVLHQGIGTKVGRDVRKGGSRVLKRHRLARAEDSDDSLLVDELDQGPAIPWGRGGSRSGPPWLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTSGIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSEGTGVDHLGPAILHELEKFPVHSLGLPALLSDPSAKTPEEALVHIFGEARRTTPSILYIPQFNLWWENAHEQLRAVLLTLLEELPSHLPILLLGSSSVPLAEVEGDPSTVFPLRSVYQVEKPSTEDRSLFLGRLIEAAVSVVLEGRSKKPQESVSLPELPKVPTVESGPKASELKAKVEAEQHALRRLRMCLRDVCNRMLYDKRFSAFHYPVTDEDAPNYRSIIQNPMDLATLLQRVDSGHYVTCSAFLQDVDLIVTNAKAYNGNDYNGTRIVSRGYELRDAVHGMLSQMDPALVSYCDKIAAQGGPTPLPDDLGGSIFPTTPVVQLGTVTRASARLRNVQPEVNLDQSYEALKRPKKSTDAPHAATVVEDKSRHQESVQQTKSCDDVEANDADTEMLESSCADGNQHDAPREACGLTEGGGSQDVTILCGEVVQEAEPIKQLFVVRTESYGIPQLERLYTRVMKGIFDIKDRDDPKPSILGFLSKFAEDEANF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1205 2.2.26 [Sep-21-2011]
F4IAE91210 ATPase family AAA domain- yes no 0.987 0.983 0.718 0.0
Q9ULI0 1458 ATPase family AAA domain- yes no 0.534 0.441 0.467 1e-173
Q6PL181390 ATPase family AAA domain- no no 0.532 0.461 0.444 1e-166
Q8CDM11040 ATPase family AAA domain- no no 0.531 0.615 0.441 1e-164
Q5RDX41091 ATPase family AAA domain- yes no 0.532 0.588 0.444 1e-163
P403401379 Tat-binding homolog 7 OS= yes no 0.526 0.460 0.403 1e-137
A8X0L91285 Tat-binding homolog 7 OS= N/A no 0.538 0.505 0.404 1e-133
O141141190 Uncharacterized AAA domai yes no 0.546 0.552 0.408 1e-131
P548161291 Tat-binding homolog 7 OS= yes no 0.544 0.508 0.395 1e-130
Q9C0W21201 Uncharacterized AAA domai no no 0.521 0.523 0.392 1e-112
>sp|F4IAE9|Y1591_ARATH ATPase family AAA domain-containing protein At1g05910 OS=Arabidopsis thaliana GN=At1g05910 PE=2 SV=1 Back     alignment and function desciption
 Score = 1635 bits (4235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 880/1225 (71%), Positives = 992/1225 (80%), Gaps = 35/1225 (2%)

Query: 1    MYSKRSGQGDGSVPGPVRTSDRLRRRPKILGRTYLYY---NPIRPRKSKTKARTAASQIA 57
            M+ KRS QGDGSV  PVRTSDRLRRRPK+ GR+YLYY   N +  RK  TK RTAASQIA
Sbjct: 1    MHPKRSSQGDGSVTKPVRTSDRLRRRPKLHGRSYLYYSSPNMLHNRKRNTKTRTAASQIA 60

Query: 58   RMFGPGKRTVRTSNKNSVPLNLRRSTRKRRISVNLEDYTDSSGSEDEDLMRPSYRPLRNR 117
            +M   G R  R SN   +  +LRRSTRKRRISVNLEDYTDSSG+EDED+M P+YR LR R
Sbjct: 61   KMLHKGNRPARASNAAPIASDLRRSTRKRRISVNLEDYTDSSGAEDEDMMSPAYRTLRRR 120

Query: 118  MRNNMSQDELSPSKRKKVVEAKPTPRREGLRPRRSMVATRKQLNLDSGDEQGSSEEKVGQ 177
            +  N S      SK +K ++A+  PRREGLRPRRS     K+L  +SG +Q +SEEK GQ
Sbjct: 121  VHKNFST-----SKSRKDMDAELAPRREGLRPRRSTTIANKRLKTESGADQDTSEEKDGQ 175

Query: 178  DETENGNESDNDADDGQNEIEGDGEAEAEDEGEGEDEEDGDDEEGEEEQEG---RRRYDL 234
            DETENGNE D DADDG+NE+E + E   EDEG+GEDE + D ++ EE  E    R+RYDL
Sbjct: 176  DETENGNELD-DADDGENEVEAEDEGNGEDEGDGEDEGEEDGDDDEEGDEEQEGRKRYDL 234

Query: 235  RNRAEVRRLSVEE--GKQRPRSPRRVLHQGIGTKVGRDVRKGGSRVLKRHRLARAEDSDD 292
            RNRAEVRR+   E   +Q+PRSPRRVLHQG+GT+VGRD R+GGSR  KRHR  R +DSDD
Sbjct: 235  RNRAEVRRMPTGEINKQQQPRSPRRVLHQGMGTRVGRDGRRGGSRPHKRHRFTRTDDSDD 294

Query: 293  SLLVDELDQGPAIPWGRGGSRSGPPWLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTS 352
            SLLVDELDQGPAIPW RGG+RSG PWLFGGL+ +G+++ GLNV ASGWGHQ D LAALTS
Sbjct: 295  SLLVDELDQGPAIPWARGGNRSGAPWLFGGLDTYGSSSLGLNVGASGWGHQSDGLAALTS 354

Query: 353  GIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITP 412
            G+QTAGPSSKGGADIQPLQ++E ++FDDIGGLSEYI+ LKEMVFFPLLYP+FFASY ITP
Sbjct: 355  GVQTAGPSSKGGADIQPLQINEDINFDDIGGLSEYINDLKEMVFFPLLYPEFFASYSITP 414

Query: 413  PRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEE 472
            PRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEE
Sbjct: 415  PRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEE 474

Query: 473  AQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDA 532
            AQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDA
Sbjct: 475  AQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDA 534

Query: 533  IDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADL 592
            IDGALRRPGRFDREFNF LPGCEARAEILDIHTRKWK PP+RELK ELAA+CVGYCGADL
Sbjct: 535  IDGALRRPGRFDREFNFSLPGCEARAEILDIHTRKWKHPPTRELKEELAATCVGYCGADL 594

Query: 593  KALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSR 652
            KALCTEAAIRAFREKYPQVYTSDDK+ IDV  V VEK HF+EAMS ITPAAHRG+ V SR
Sbjct: 595  KALCTEAAIRAFREKYPQVYTSDDKYAIDVGLVNVEKSHFVEAMSAITPAAHRGSVVQSR 654

Query: 653  PLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSE 712
            PLS VV PCL RHL ++M+ ISDIFP    SSELTKL +L+ GSAIPLVYRPRLLL G E
Sbjct: 655  PLSPVVLPCLHRHLLESMSLISDIFPSSATSSELTKLSILTFGSAIPLVYRPRLLLLGGE 714

Query: 713  GTGVDHLGPAILHELEKFPVHSLGLPALLSDPSAKTPEEALVHIFGEARRTTPSILYIPQ 772
            G G+DHLGPAILHELEKFP+HSLGLP+LLSDP AKTPEEALVHIF EARRTTPSILYIP 
Sbjct: 715  GVGLDHLGPAILHELEKFPIHSLGLPSLLSDPGAKTPEEALVHIFSEARRTTPSILYIPM 774

Query: 773  FNLWWENAHEQLRAVLLTLLEELPSHLPILLLGSSSVPLAEVEGDPSTVFPLRSVYQVEK 832
            FN WWENAHEQLRAV LTLLEELPS+LPILLL +S   L+++E    +VF  RSVY V+K
Sbjct: 775  FNNWWENAHEQLRAVFLTLLEELPSNLPILLLATSYGELSDME--EQSVFDNRSVYTVDK 832

Query: 833  PSTEDRSLFLGRLIEAAVSVVLEGRSKKPQESVSLPELPKVPTVESGPKASELKAKVEAE 892
            PS+EDRSLF  RLIEAA+SV+  G + KP     LPELPKVP   +GPK +E+KAKVEAE
Sbjct: 833  PSSEDRSLFFDRLIEAALSVI-SGLNGKPDGPQPLPELPKVPKEPTGPKPAEVKAKVEAE 891

Query: 893  QHALRRLRMCLRDVCNRMLYDKRFSAFHYPVTDEDAPNYRSIIQNPMDLATLLQRVDSGH 952
            QHALRRLRMCLRDVCNR+LYDKRFSAFH+PVTDEDAPNYRSIIQ PMD ATLLQRVD+G 
Sbjct: 892  QHALRRLRMCLRDVCNRILYDKRFSAFHFPVTDEDAPNYRSIIQIPMDTATLLQRVDTGQ 951

Query: 953  YVTCSAFLQDVDLIVTNAKAYNGNDYNGTRIVSRGYELRDAVHGMLSQMDPALVSYCDKI 1012
            Y+TC+ FLQDVDLIV NAKAYNG+DY G RIVSR YELRD VHGMLSQMDPAL++YCDKI
Sbjct: 952  YLTCTPFLQDVDLIVRNAKAYNGDDYAGARIVSRAYELRDVVHGMLSQMDPALLTYCDKI 1011

Query: 1013 AAQGGPTPLPDDLGGSIFPTTPVVQLGTVTRASARLRNVQPEVNLDQSYEALKRPKKSTD 1072
            AA+GGP+ +PDDL GSI    PVVQ+GTVTR SARLRNVQPEVNLD+ YE LK+PKK+TD
Sbjct: 1012 AAEGGPSLIPDDLSGSILGLAPVVQMGTVTRTSARLRNVQPEVNLDRDYEGLKKPKKTTD 1071

Query: 1073 APHAATVVEDKSRHQESVQQTKSCDDVEANDADTEMLESSCADGNQHDA----PREACGL 1128
            A    +   DKS++Q+S Q+  S D      A+ +    S  DG++ D      +EA   
Sbjct: 1072 AVSIDSAA-DKSQNQDSGQEMPSPD-----AANPQSAAPSPTDGDREDQSEPPSKEASAE 1125

Query: 1129 TEGGGSQD--VTILCGEVVQEAEPIKQLFVVRTESYGIPQLERLYTRVMKGIFDIKD--- 1183
               G S          E+    E +K +F+ RT++Y IPQ+ERLYTR+MKG+ +  D   
Sbjct: 1126 DMSGDSCKGPAAKSDKEISSRTESVKGVFMERTDNYSIPQMERLYTRIMKGVLETLDKGL 1185

Query: 1184 RDD---PKPSILGFLSKFAEDEANF 1205
            RDD   PK SIL FLS+FA+ +ANF
Sbjct: 1186 RDDDNNPKHSILRFLSEFAQHQANF 1210

Arabidopsis thaliana (taxid: 3702)
>sp|Q9ULI0|ATD2B_HUMAN ATPase family AAA domain-containing protein 2B OS=Homo sapiens GN=ATAD2B PE=1 SV=3 Back     alignment and function description
>sp|Q6PL18|ATAD2_HUMAN ATPase family AAA domain-containing protein 2 OS=Homo sapiens GN=ATAD2 PE=1 SV=1 Back     alignment and function description
>sp|Q8CDM1|ATAD2_MOUSE ATPase family AAA domain-containing protein 2 OS=Mus musculus GN=Atad2 PE=1 SV=1 Back     alignment and function description
>sp|Q5RDX4|ATAD2_PONAB ATPase family AAA domain-containing protein 2 OS=Pongo abelii GN=ATAD2 PE=2 SV=1 Back     alignment and function description
>sp|P40340|TBP7_YEAST Tat-binding homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA7 PE=1 SV=2 Back     alignment and function description
>sp|A8X0L9|TBP7_CAEBR Tat-binding homolog 7 OS=Caenorhabditis briggsae GN=lex-1 PE=3 SV=2 Back     alignment and function description
>sp|O14114|YEJJ_SCHPO Uncharacterized AAA domain-containing protein C31G5.19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31G5.19 PE=3 SV=1 Back     alignment and function description
>sp|P54816|TBP7_CAEEL Tat-binding homolog 7 OS=Caenorhabditis elegans GN=lex-1 PE=1 SV=3 Back     alignment and function description
>sp|Q9C0W2|YHI5_SCHPO Uncharacterized AAA domain-containing protein P22H7.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi026 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1205
2240931541219 bromodomain protein [Populus trichocarpa 0.995 0.984 0.801 0.0
2254338621218 PREDICTED: ATPase family AAA domain-cont 0.999 0.988 0.785 0.0
2241331261157 bromodomain protein [Populus trichocarpa 0.954 0.993 0.791 0.0
3565454891201 PREDICTED: ATPase family AAA domain-cont 0.990 0.994 0.773 0.0
3565389051196 PREDICTED: ATPase family AAA domain-cont 0.987 0.994 0.768 0.0
2977437711105 unnamed protein product [Vitis vinifera] 0.907 0.989 0.722 0.0
2978433901208 hypothetical protein ARALYDRAFT_470606 [ 0.987 0.985 0.717 0.0
183905881210 cell division cycle protein 48-like prot 0.987 0.983 0.718 0.0
159837591210 At1g05910/T20M3_16 [Arabidopsis thaliana 0.987 0.983 0.717 0.0
4495268981148 PREDICTED: LOW QUALITY PROTEIN: ATPase f 0.946 0.993 0.694 0.0
>gi|224093154|ref|XP_002309811.1| bromodomain protein [Populus trichocarpa] gi|222852714|gb|EEE90261.1| bromodomain protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1924 bits (4984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 981/1224 (80%), Positives = 1060/1224 (86%), Gaps = 24/1224 (1%)

Query: 1    MYSKRSGQGDGSVPGPVRTSDRLRRRPKILGRTYLYYNP--IRPRKSKTKARTAASQIAR 58
            MYSKRSGQGDG  P PVRTSDRLRRRPK+  RTYLYY P  IRPRK KTK RTAAS+IA+
Sbjct: 1    MYSKRSGQGDGPGPRPVRTSDRLRRRPKVFSRTYLYYTPGIIRPRKGKTKTRTAASRIAK 60

Query: 59   MFGPGKRTVRTSNKNSVPLNLRRSTRKRRISVNLEDYTDSSGSEDEDLMRPSYRPLRNRM 118
            M G   R VR +N NSVP NLRRSTRKRR+S +LEDYTDSSGSEDEDLMRP++RPLRNR+
Sbjct: 61   MLG--NRAVRAANANSVPTNLRRSTRKRRLSAHLEDYTDSSGSEDEDLMRPAFRPLRNRI 118

Query: 119  RNNMSQDELSPSKRKKVVEAKPTPRREGLRPRRSMVATRKQLNLDSGDEQGSS-EEKVGQ 177
             N+ SQDELS SKRKK VE K TPRREGLRPRRS    +K L L+SGDEQ +S E+ V  
Sbjct: 119  HNSASQDELSSSKRKKNVETKSTPRREGLRPRRSRTIIKKPLTLESGDEQDTSEEKAVQD 178

Query: 178  DETENGNESDNDADDGQNEIEGDGEAEAEDEGEGEDEEDGDDEEGEEE------------ 225
            +     +  DNDADDGQN+ E + E + E  GEGE E + + EE +++            
Sbjct: 179  ETENGNDIDDNDADDGQNDDEAEDEGDGEGAGEGEGEGEDEGEEDDDDDDDDEGEEEEEE 238

Query: 226  QEGRRRYDLRNRAEVRRLSVEEGKQRPRSPRRVLHQGIGTKVGRDVRKGGSRVLKRHRLA 285
            Q+GRRRYDLRNRAEVRRLS+EEGKQRPRSPRRVLHQG+GTKV RDVRKGGSRV KRHRL+
Sbjct: 239  QDGRRRYDLRNRAEVRRLSMEEGKQRPRSPRRVLHQGMGTKVNRDVRKGGSRVHKRHRLS 298

Query: 286  RAEDSDDSLLVDELDQGPAIPWGRGGSRSGPPWLFGGLEMHGTTAWGLNVAASGWGHQGD 345
            RAEDSDDSLLVDELDQGPAIPW RGGSRSGPPWL GGLEMHGTT WGLNVAASGWGHQGD
Sbjct: 299  RAEDSDDSLLVDELDQGPAIPWARGGSRSGPPWLLGGLEMHGTTTWGLNVAASGWGHQGD 358

Query: 346  TLAALTSGIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFF 405
             LA+LTSG+QTAGPSSKGGADIQPLQVDE+VSFDDIGGLS YIDALKEMVFFPLLYPDFF
Sbjct: 359  ALASLTSGVQTAGPSSKGGADIQPLQVDETVSFDDIGGLSGYIDALKEMVFFPLLYPDFF 418

Query: 406  ASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQ 465
            ASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQ
Sbjct: 419  ASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQ 478

Query: 466  LKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIG 525
            LKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIG
Sbjct: 479  LKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIG 538

Query: 526  ATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCV 585
            ATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWK PPS+ELKSELAA+CV
Sbjct: 539  ATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKHPPSKELKSELAANCV 598

Query: 586  GYCGADLKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHR 645
            GYCGADLKALCTEAAIRAFREKYPQVYTSDDKF+IDVDSV VEKYHF+EAMSTITPAAHR
Sbjct: 599  GYCGADLKALCTEAAIRAFREKYPQVYTSDDKFVIDVDSVKVEKYHFVEAMSTITPAAHR 658

Query: 646  GATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPR 705
            GA VHSRPLSLVVAPCLQ HLQKAMN +SDIF PL +SSE  KL MLS+GSAIPLVYRPR
Sbjct: 659  GAVVHSRPLSLVVAPCLQSHLQKAMNCLSDIFSPLAVSSEFIKLSMLSYGSAIPLVYRPR 718

Query: 706  LLLCGSEGTGVDHLGPAILHELEKFPVHSLGLPALLSDPSAKTPEEALVHIFGEARRTTP 765
            LLLCG EG+G+DHLGPA+LHELEKFPVHSLGLP+LLSDPSAKTPEEALVHIFGEARR TP
Sbjct: 719  LLLCGCEGSGLDHLGPAVLHELEKFPVHSLGLPSLLSDPSAKTPEEALVHIFGEARRATP 778

Query: 766  SILYIPQFNLWWENAHEQLRAVLLTLLEELPSHLPILLLGSSSVPLAEVEGDPSTVFPLR 825
            SILYI  F+LWW+NAHEQLRAVLLTLLEELPS LPILLLGSSS P AE++G  S+VFP  
Sbjct: 779  SILYISHFDLWWDNAHEQLRAVLLTLLEELPSDLPILLLGSSSSPPAEIDG-ASSVFPDH 837

Query: 826  SVYQVEKPSTEDRSLFLGRLIEAAVSVVLEGRSKKPQESVSLPELPKVPTVESGPKASEL 885
            SVYQV KPST DRSLF  RLIEAA+SVVLE  +KK Q S  LPELPK   V SGPKASEL
Sbjct: 838  SVYQVGKPSTGDRSLFFDRLIEAALSVVLEDVAKKSQGSSPLPELPKAQKVASGPKASEL 897

Query: 886  KAKVEAEQHALRRLRMCLRDVCNRMLYDKRFSAFHYPVTDEDAPNYRSIIQNPMDLATLL 945
            KAK+EAEQHALRR+RMCLRD+CNR+LYDKRFSAFHYPVTDEDAPNYRSIIQNPMD+AT+L
Sbjct: 898  KAKIEAEQHALRRMRMCLRDICNRVLYDKRFSAFHYPVTDEDAPNYRSIIQNPMDMATML 957

Query: 946  QRVDSGHYVTCSAFLQDVDLIVTNAKAYNGNDYNGTRIVSRGYELRDAVHGMLSQMDPAL 1005
            QRVDSG Y+TCSAFLQD+DLIVTNAK YNG+DYNG RIVSR YELRDAVHGMLSQMDPAL
Sbjct: 958  QRVDSGQYITCSAFLQDIDLIVTNAKVYNGDDYNGARIVSRSYELRDAVHGMLSQMDPAL 1017

Query: 1006 VSYCDKIAAQGGPTPLPDDLGGSIFPTTPVVQLGTVTRASARLRNVQPEVNLDQSYEALK 1065
            V+YCDKIAAQGGP  +PDDLGGSIFP+TPVVQLGT TR SARLRNVQP+VNLDQSYEALK
Sbjct: 1018 VTYCDKIAAQGGPVQVPDDLGGSIFPSTPVVQLGT-TRTSARLRNVQPDVNLDQSYEALK 1076

Query: 1066 RPKKSTDAPHAATVVEDKSRHQESVQQTKSCDDVEANDADTEMLESSCADGNQHDAP-RE 1124
            R KK+ DA HAA+  EDKSRHQ+SV Q K  ++ +A+D + +  ESS AD  QH+    E
Sbjct: 1077 RQKKNADATHAASTAEDKSRHQDSV-QAKLPEEHDADDMNPDRPESSSADDIQHETSGGE 1135

Query: 1125 ACGLTEGGGSQDVTILCGEVVQEAEPIKQLFVVRTESYGIPQLERLYTRVMKGIFDIKDR 1184
            A G  EG GSQD T+   E     E IK+L V RTE+Y IPQLERLYTR+MKGIF+ KD+
Sbjct: 1136 ASGHIEGSGSQDATMSDAEASSHGEYIKRLLVERTENYDIPQLERLYTRIMKGIFETKDK 1195

Query: 1185 ---DDPKPSILGFLSKFAEDEANF 1205
               D P+ SIL FL KFAED ANF
Sbjct: 1196 GYEDGPRYSILRFLVKFAEDAANF 1219

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225433862|ref|XP_002264772.1| PREDICTED: ATPase family AAA domain-containing protein 2B-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224133126|ref|XP_002327967.1| bromodomain protein [Populus trichocarpa] gi|222837376|gb|EEE75755.1| bromodomain protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356545489|ref|XP_003541174.1| PREDICTED: ATPase family AAA domain-containing protein 2B-like [Glycine max] Back     alignment and taxonomy information
>gi|356538905|ref|XP_003537941.1| PREDICTED: ATPase family AAA domain-containing protein 2B-like [Glycine max] Back     alignment and taxonomy information
>gi|297743771|emb|CBI36654.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297843390|ref|XP_002889576.1| hypothetical protein ARALYDRAFT_470606 [Arabidopsis lyrata subsp. lyrata] gi|297335418|gb|EFH65835.1| hypothetical protein ARALYDRAFT_470606 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18390588|ref|NP_563753.1| cell division cycle protein 48-like protein [Arabidopsis thaliana] gi|378525243|sp|F4IAE9.1|Y1591_ARATH RecName: Full=ATPase family AAA domain-containing protein At1g05910 gi|332189796|gb|AEE27917.1| cell division cycle protein 48-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15983759|gb|AAL10476.1| At1g05910/T20M3_16 [Arabidopsis thaliana] gi|27363450|gb|AAO11644.1| At1g05910/T20M3_16 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449526898|ref|XP_004170450.1| PREDICTED: LOW QUALITY PROTEIN: ATPase family AAA domain-containing protein At1g05910-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1205
TAIR|locus:21987481210 AT1G05910 [Arabidopsis thalian 0.990 0.985 0.672 0.0
ZFIN|ZDB-GENE-030131-5754 1358 wu:fi16e04 "wu:fi16e04" [Danio 0.260 0.231 0.608 3e-163
UNIPROTKB|E2RRW1 1373 ATAD2 "Uncharacterized protein 0.260 0.228 0.605 6e-163
UNIPROTKB|F1RR16 1388 ATAD2 "Uncharacterized protein 0.276 0.239 0.575 1.4e-161
ZFIN|ZDB-GENE-110411-210 1402 atad2b "ATPase family, AAA dom 0.260 0.223 0.592 2.6e-160
UNIPROTKB|E1BC78 1372 ATAD2 "Uncharacterized protein 0.260 0.228 0.595 3e-160
UNIPROTKB|F1MEU3 1248 ATAD2B "Uncharacterized protei 0.260 0.251 0.601 6.9e-160
UNIPROTKB|F1MEY1 1465 ATAD2B "Uncharacterized protei 0.260 0.214 0.601 1e-159
UNIPROTKB|J9NU31 1291 ATAD2B "Uncharacterized protei 0.260 0.243 0.601 2.9e-159
UNIPROTKB|Q9ULI0 1458 ATAD2B "ATPase family AAA doma 0.260 0.215 0.601 1.1e-158
TAIR|locus:2198748 AT1G05910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 4004 (1414.5 bits), Expect = 0., P = 0.
 Identities = 822/1222 (67%), Positives = 922/1222 (75%)

Query:     1 MYSKRSGQGDGSVPGPVRTSDRLRRRPKILGRTYLYY---NPIRPRKSKTKARTAASQIA 57
             M+ KRS QGDGSV  PVRTSDRLRRRPK+ GR+YLYY   N +  RK  TK RTAASQIA
Sbjct:     1 MHPKRSSQGDGSVTKPVRTSDRLRRRPKLHGRSYLYYSSPNMLHNRKRNTKTRTAASQIA 60

Query:    58 RMFGPGKRTVRTSNKNSVPLNLRRSTRKRRISVNLEDYTDSSGSEDEDLMRPSYRPLRNR 117
             +M   G R  R SN   +  +LRRSTRKRRISVNLEDYTDSSG+EDED+M P+YR LR R
Sbjct:    61 KMLHKGNRPARASNAAPIASDLRRSTRKRRISVNLEDYTDSSGAEDEDMMSPAYRTLRRR 120

Query:   118 MRNNMSQDELSPSKRKKVVEAKPTPRREGLRPRRSMVATRKQLNLDSGDEQGSSEEKVGQ 177
             +  N S      SK +K ++A+  PRREGLRPRRS     K+L  +SG +Q +SEEK GQ
Sbjct:   121 VHKNFST-----SKSRKDMDAELAPRREGLRPRRSTTIANKRLKTESGADQDTSEEKDGQ 175

Query:   178 DETENGNESDNDADDGQNEIXXXXXXXXXXXXXXXXXXXXXXXXXXXX---QEGRRRYDL 234
             DETENGNE D DADDG+NE+                               QEGR+RYDL
Sbjct:   176 DETENGNELD-DADDGENEVEAEDEGNGEDEGDGEDEGEEDGDDDEEGDEEQEGRKRYDL 234

Query:   235 RNRAEVRRLSVEE--GKQRPRSPRRVLHQGIGTKVGRDVRKGGSRVLKRHRLARAXXXXX 292
             RNRAEVRR+   E   +Q+PRSPRRVLHQG+GT+VGRD R+GGSR  KRHR  R      
Sbjct:   235 RNRAEVRRMPTGEINKQQQPRSPRRVLHQGMGTRVGRDGRRGGSRPHKRHRFTRTDDSDD 294

Query:   293 XXXXXXXXQGPAIXXXXXXXXXXXXXLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTS 352
                     QGPAI             LFGGL+ +G+++ GLNV ASGWGHQ D LAALTS
Sbjct:   295 SLLVDELDQGPAIPWARGGNRSGAPWLFGGLDTYGSSSLGLNVGASGWGHQSDGLAALTS 354

Query:   353 GIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITP 412
             G+QTAGPSSKGGADIQPLQ++E ++FDDIGGLSEYI+ LKEMVFFPLLYP+FFASY ITP
Sbjct:   355 GVQTAGPSSKGGADIQPLQINEDINFDDIGGLSEYINDLKEMVFFPLLYPEFFASYSITP 414

Query:   413 PRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEE 472
             PRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEE
Sbjct:   415 PRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEE 474

Query:   473 AQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDA 532
             AQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDA
Sbjct:   475 AQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDA 534

Query:   533 IDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADL 592
             IDGALRRPGRFDREFNF LPGCEARAEILDIHTRKWK PP+RELK ELAA+CVGYCGADL
Sbjct:   535 IDGALRRPGRFDREFNFSLPGCEARAEILDIHTRKWKHPPTRELKEELAATCVGYCGADL 594

Query:   593 KALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSR 652
             KALCTEAAIRAFREKYPQVYTSDDK+ IDV  V VEK HF+EAMS ITPAAHRG+ V SR
Sbjct:   595 KALCTEAAIRAFREKYPQVYTSDDKYAIDVGLVNVEKSHFVEAMSAITPAAHRGSVVQSR 654

Query:   653 PLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSE 712
             PLS VV PCL RHL ++M+ ISDIFP    SSELTKL +L+ GSAIPLVYRPRLLL G E
Sbjct:   655 PLSPVVLPCLHRHLLESMSLISDIFPSSATSSELTKLSILTFGSAIPLVYRPRLLLLGGE 714

Query:   713 GTGVDHLGPAILHELEKFPVHSLGLPALLSDPSAKTPEEALVHIFGEARRTTPSILYIPQ 772
             G G+DHLGPAILHELEKFP+HSLGLP+LLSDP AKTPEEALVHIF EARRTTPSILYIP 
Sbjct:   715 GVGLDHLGPAILHELEKFPIHSLGLPSLLSDPGAKTPEEALVHIFSEARRTTPSILYIPM 774

Query:   773 FNLWWENAHXXXXXXXXXXXXXXXXXXPILLLGSSSVPLAEVEGDPSTVFPLRSVYQVEK 832
             FN WWENAH                  PILLL +S   L+++E    +VF  RSVY V+K
Sbjct:   775 FNNWWENAHEQLRAVFLTLLEELPSNLPILLLATSYGELSDME--EQSVFDNRSVYTVDK 832

Query:   833 PSTEDRSLFLGRLIEAAVSVVLEGRSKKPQESVSLPELPKVPTVESGPKASELKAKVEAE 892
             PS+EDRSLF  RLIEAA+SV+  G + KP     LPELPKVP   +GPK +E+KAKVEAE
Sbjct:   833 PSSEDRSLFFDRLIEAALSVI-SGLNGKPDGPQPLPELPKVPKEPTGPKPAEVKAKVEAE 891

Query:   893 QHALRRLRMCLRDVCNRMLYDKRFSAFHYPVTDEDAPNYRSIIQNPMDLATLLQRVDSGH 952
             QHALRRLRMCLRDVCNR+LYDKRFSAFH+PVTDEDAPNYRSIIQ PMD ATLLQRVD+G 
Sbjct:   892 QHALRRLRMCLRDVCNRILYDKRFSAFHFPVTDEDAPNYRSIIQIPMDTATLLQRVDTGQ 951

Query:   953 YVTCSAFLQDVDLIVTNAKAYNGNDYNGTRIVSRGYELRDAVHGMLSQMDPALVSYCDKI 1012
             Y+TC+ FLQDVDLIV NAKAYNG+DY G RIVSR YELRD VHGMLSQMDPAL++YCDKI
Sbjct:   952 YLTCTPFLQDVDLIVRNAKAYNGDDYAGARIVSRAYELRDVVHGMLSQMDPALLTYCDKI 1011

Query:  1013 AAQXXXXXXXXXXXXSIFPTTPVVQLGTVTRASARLRNVQPEVNLDQSYEALKRPKKSTD 1072
             AA+            SI    PVVQ+GTVTR SARLRNVQPEVNLD+ YE LK+PKK+TD
Sbjct:  1012 AAEGGPSLIPDDLSGSILGLAPVVQMGTVTRTSARLRNVQPEVNLDRDYEGLKKPKKTTD 1071

Query:  1073 APHAATVVEDKSRHQESVQQTKSCDDVEANDADTEMLESSCADGNQHDAP-REACGLTEG 1131
             A    +   DKS++Q+S Q+  S D      A     +    D  Q + P +EA      
Sbjct:  1072 AVSIDSAA-DKSQNQDSGQEMPSPDAANPQSAAPSPTDGDRED--QSEPPSKEASAEDMS 1128

Query:  1132 GGSQDVTILCG--EVVQEAEPIKQLFVVRTESYGIPQLERLYTRVMKGIFDIKD---RDD 1186
             G S          E+    E +K +F+ RT++Y IPQ+ERLYTR+MKG+ +  D   RDD
Sbjct:  1129 GDSCKGPAAKSDKEISSRTESVKGVFMERTDNYSIPQMERLYTRIMKGVLETLDKGLRDD 1188

Query:  1187 ---PKPSILGFLSKFAEDEANF 1205
                PK SIL FLS+FA+ +ANF
Sbjct:  1189 DNNPKHSILRFLSEFAQHQANF 1210
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
ZFIN|ZDB-GENE-030131-5754 wu:fi16e04 "wu:fi16e04" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRW1 ATAD2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RR16 ATAD2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110411-210 atad2b "ATPase family, AAA domain containing 2B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BC78 ATAD2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MEU3 ATAD2B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MEY1 ATAD2B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NU31 ATAD2B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ULI0 ATAD2B "ATPase family AAA domain-containing protein 2B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
F4IAE9Y1591_ARATHNo assigned EC number0.71830.98750.9834yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
BRD906
bromodomain protein (1219 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_Genewise1_v1.C_290097
hypothetical protein (465 aa)
  •     0.473
eugene3.00030772
hypothetical protein (464 aa)
  •     0.472

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1205
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 5e-68
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 1e-67
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 2e-67
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 2e-65
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 1e-61
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 3e-60
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 2e-52
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 2e-50
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 4e-50
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 2e-48
CHL00176638 CHL00176, ftsH, cell division protein; Validated 7e-48
pfam00004131 pfam00004, AAA, ATPase family associated with vari 5e-45
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 1e-44
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 1e-43
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 8e-43
PRK10733644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 1e-34
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 4e-34
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-27
cd0436999 cd04369, Bromodomain, Bromodomain 1e-22
smart00382148 smart00382, AAA, ATPases associated with a variety 7e-20
smart00297107 smart00297, BROMO, bromo domain 2e-18
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 9e-17
pfam0043984 pfam00439, Bromodomain, Bromodomain 5e-15
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 2e-14
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 4e-14
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 3e-13
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 4e-13
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 5e-13
COG5076371 COG5076, COG5076, Transcription factor involved in 2e-11
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 2e-11
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 2e-11
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 3e-11
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 8e-11
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 1e-10
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 1e-10
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 3e-10
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 5e-10
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 4e-09
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 7e-09
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 9e-09
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 4e-08
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 5e-08
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 7e-08
TIGR03922557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 9e-08
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 2e-07
COG54061001 COG5406, COG5406, Nucleosome binding factor SPN, S 3e-06
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 3e-06
COG2256436 COG2256, MGS1, ATPase related to the helicase subu 7e-06
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 1e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 1e-05
pfam04147809 pfam04147, Nop14, Nop14-like family 2e-05
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 3e-05
PRK13342413 PRK13342, PRK13342, recombination factor protein R 4e-05
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 4e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 5e-05
pfam04147809 pfam04147, Nop14, Nop14-like family 6e-05
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 6e-05
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 8e-05
COG4547620 COG4547, CobT, Cobalamin biosynthesis protein CobT 8e-05
pfam01695178 pfam01695, IstB_IS21, IstB-like ATP binding protei 8e-05
pfam04147809 pfam04147, Nop14, Nop14-like family 1e-04
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 1e-04
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 1e-04
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 1e-04
cd05525106 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa 2e-04
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-04
COG5137279 COG5137, COG5137, Histone chaperone involved in ge 2e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-04
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 2e-04
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 3e-04
PRK12678672 PRK12678, PRK12678, transcription termination fact 3e-04
pfam04147809 pfam04147, Nop14, Nop14-like family 5e-04
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 5e-04
pfam06068395 pfam06068, TIP49, TIP49 C-terminus 5e-04
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 5e-04
pfam1225376 pfam12253, CAF1A, Chromatin assembly factor 1 subu 6e-04
COG54061001 COG5406, COG5406, Nucleosome binding factor SPN, S 7e-04
PRK05342412 PRK05342, clpX, ATP-dependent protease ATP-binding 7e-04
pfam03344715 pfam03344, Daxx, Daxx Family 8e-04
pfam04147809 pfam04147, Nop14, Nop14-like family 0.001
pfam13401124 pfam13401, AAA_22, AAA domain 0.001
pfam05285317 pfam05285, SDA1, SDA1 0.001
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 0.002
pfam04147809 pfam04147, Nop14, Nop14-like family 0.002
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 0.002
COG1219408 COG1219, ClpX, ATP-dependent protease Clp, ATPase 0.002
COG0542786 COG0542, clpA, ATP-binding subunits of Clp proteas 0.002
TIGR02639730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 0.002
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.003
PRK12678672 PRK12678, PRK12678, transcription termination fact 0.003
PRK12678672 PRK12678, PRK12678, transcription termination fact 0.003
CHL00095821 CHL00095, clpC, Clp protease ATP binding subunit 0.003
PRK09183259 PRK09183, PRK09183, transposase/IS protein; Provis 0.003
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.004
COG5414392 COG5414, COG5414, TATA-binding protein-associated 0.004
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 0.004
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 0.004
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information 
 Score =  243 bits (622), Expect = 5e-68
 Identities = 149/406 (36%), Positives = 221/406 (54%), Gaps = 31/406 (7%)

Query: 376 VSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALAC 435
           V+++DIGGL E  + ++EMV  P+ +P+ F    I PP+GVLL GPPGTGKTL+A+A+A 
Sbjct: 175 VTYEDIGGLKEAKEKIREMVELPMKHPELFEHLGIEPPKGVLLYGPPGTGKTLLAKAVAN 234

Query: 436 AASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSS 495
            A        F    G +++SK+ GE+E +L+ +F+EA+ N PSIIF DEID +AP R  
Sbjct: 235 EAG-----AYFISINGPEIMSKYYGESEERLREIFKEAEENAPSIIFIDEIDAIAPKREE 289

Query: 496 KQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCE 555
              ++   +V+ LL LMDGL  RG+V++IGATNR DA+D ALRRPGRFDRE    +P   
Sbjct: 290 VTGEVEKRVVAQLLTLMDGLKGRGRVIVIGATNRPDALDPALRRPGRFDREIVIRVPDKR 349

Query: 556 ARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSD 615
           AR EIL +HTR        +L  +LA    G+ GADL AL  EAA+ A R    +   + 
Sbjct: 350 ARKEILKVHTRNMPLAEDVDLD-KLAEVTHGFVGADLAALAKEAAMAALRRFIREGKINF 408

Query: 616 DKFLID---VDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQ---RHLQKA 669
           +   I    +  + V    F+EA+  + P+A R   V    +       L+   + L++A
Sbjct: 409 EAEEIPAEVLKELKVTMKDFMEALKMVEPSAIREVLVEVPNVRWSDIGGLEEVKQELREA 468

Query: 670 MNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPR-LLLCGSEGTGVDHLGPAILHELE 728
           + +      PL       K+           +  P+ +LL G  GTG   L  A+  E  
Sbjct: 469 VEW------PLKHPEIFEKMG----------IRPPKGVLLFGPPGTGKTLLAKAVATESG 512

Query: 729 KFPVHSLGLPALLSDPSAKTPEEALVHIFGEARRTTPSILYIPQFN 774
              +   G P +LS    ++ E+A+  IF +AR+  P+I++  + +
Sbjct: 513 ANFIAVRG-PEILSKWVGES-EKAIREIFRKARQAAPAIIFFDEID 556

This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. Length = 733
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|110677 pfam01695, IstB_IS21, IstB-like ATP binding protein Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|147949 pfam06068, TIP49, TIP49 C-terminus Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A Back     alignment and domain information
>gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|235422 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|224140 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|214361 CHL00095, clpC, Clp protease ATP binding subunit Back     alignment and domain information
>gnl|CDD|181681 PRK09183, PRK09183, transposase/IS protein; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1205
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG07321080 consensus AAA+-type ATPase containing the bromodom 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0734752 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0731774 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
CHL00195489 ycf46 Ycf46; Provisional 99.98
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.98
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.97
CHL00195489 ycf46 Ycf46; Provisional 99.97
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.97
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.97
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.97
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.97
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.96
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.96
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.96
CHL00176638 ftsH cell division protein; Validated 99.96
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.96
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.95
CHL002062281 ycf2 Ycf2; Provisional 99.95
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.95
CHL00095821 clpC Clp protease ATP binding subunit 99.95
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.94
KOG0734752 consensus AAA+-type ATPase containing the peptidas 99.94
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.94
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.94
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.94
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.94
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.93
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.93
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.93
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.93
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.93
PRK10865857 protein disaggregation chaperone; Provisional 99.93
KOG0731774 consensus AAA+-type ATPase containing the peptidas 99.92
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.91
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 99.91
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.9
PRK03992389 proteasome-activating nucleotidase; Provisional 99.89
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.89
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.88
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.88
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.87
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.87
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.87
CHL00206 2281 ycf2 Ycf2; Provisional 99.87
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.86
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.86
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.85
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.85
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.84
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.84
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.84
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.84
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.84
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.83
CHL00176638 ftsH cell division protein; Validated 99.83
CHL00181287 cbbX CbbX; Provisional 99.83
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.83
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.82
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.82
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.82
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.81
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.81
KOG1474 640 consensus Transcription initiation factor TFIID, s 99.81
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.81
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.8
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.8
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.79
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.79
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.79
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.78
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.78
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.77
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.77
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.75
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.74
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.74
PF00004132 AAA: ATPase family associated with various cellula 99.74
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.74
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.73
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.73
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.73
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.73
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.73
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.72
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.72
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 99.72
smart00297107 BROMO bromo domain. 99.71
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.68
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.67
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.67
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.65
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.64
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.63
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.63
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.62
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.62
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.6
PF00004132 AAA: ATPase family associated with various cellula 99.58
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.58
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.57
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 99.55
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.55
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 99.54
PRK00149450 dnaA chromosomal replication initiation protein; R 99.54
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.52
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.52
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.51
KOG2028554 consensus ATPase related to the helicase subunit o 99.51
PRK06893229 DNA replication initiation factor; Validated 99.51
PLN03025319 replication factor C subunit; Provisional 99.5
PRK08084235 DNA replication initiation factor; Provisional 99.5
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.5
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.49
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 99.49
PRK14088440 dnaA chromosomal replication initiation protein; P 99.49
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.48
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 99.47
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 99.46
PRK14086617 dnaA chromosomal replication initiation protein; P 99.46
PRK08727233 hypothetical protein; Validated 99.45
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.45
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 99.45
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.45
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 99.45
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.44
PRK12402337 replication factor C small subunit 2; Reviewed 99.44
PRK13342413 recombination factor protein RarA; Reviewed 99.43
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.43
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.43
PRK07940394 DNA polymerase III subunit delta'; Validated 99.43
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.43
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 99.42
PRK04195482 replication factor C large subunit; Provisional 99.42
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 99.41
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 99.41
CHL00181287 cbbX CbbX; Provisional 99.41
PTZ001121164 origin recognition complex 1 protein; Provisional 99.41
COG5076371 Transcription factor involved in chromatin remodel 99.41
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.4
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.4
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 99.4
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 99.39
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.39
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 99.39
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 99.39
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 99.39
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 99.39
PRK12422445 chromosomal replication initiation protein; Provis 99.38
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.38
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 99.38
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 99.37
PRK05642234 DNA replication initiation factor; Validated 99.37
PRK13341725 recombination factor protein RarA/unknown domain f 99.36
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.36
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 99.36
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.35
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 99.35
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 99.34
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.34
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.34
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.34
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.33
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.32
PHA02544316 44 clamp loader, small subunit; Provisional 99.32
PRK00440319 rfc replication factor C small subunit; Reviewed 99.32
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 99.32
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 99.32
PRK14087450 dnaA chromosomal replication initiation protein; P 99.32
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.32
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.31
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.31
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.3
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.3
KOG0943 3015 consensus Predicted ubiquitin-protein ligase/hyper 99.28
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.28
COG0593408 DnaA ATPase involved in DNA replication initiation 99.27
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.27
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.26
PRK06620214 hypothetical protein; Validated 99.26
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 99.25
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 99.25
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 99.25
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.23
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.23
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.22
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.2
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 99.18
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.17
PRK09087226 hypothetical protein; Validated 99.17
PRK10865857 protein disaggregation chaperone; Provisional 99.15
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.13
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.13
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.13
KOG1472720 consensus Histone acetyltransferase SAGA/ADA, cata 99.13
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.12
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.11
CHL00095821 clpC Clp protease ATP binding subunit 99.11
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 99.11
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.1
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.1
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.09
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 99.08
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.07
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 99.04
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.04
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.03
PRK09112351 DNA polymerase III subunit delta'; Validated 99.01
PRK07471365 DNA polymerase III subunit delta'; Validated 99.01
PRK05564313 DNA polymerase III subunit delta'; Validated 98.99
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.97
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 98.97
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.97
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 98.96
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 98.94
PRK06893229 DNA replication initiation factor; Validated 98.92
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.91
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.91
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.9
KOG1969877 consensus DNA replication checkpoint protein CHL12 98.89
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 98.89
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 98.89
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.88
PRK04132846 replication factor C small subunit; Provisional 98.86
PRK07399314 DNA polymerase III subunit delta'; Validated 98.85
PHA02244383 ATPase-like protein 98.85
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.85
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.84
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 98.84
COG0714329 MoxR-like ATPases [General function prediction onl 98.84
COG2255332 RuvB Holliday junction resolvasome, helicase subun 98.83
PRK13531498 regulatory ATPase RavA; Provisional 98.83
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.82
smart00382148 AAA ATPases associated with a variety of cellular 98.82
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 98.81
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.81
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.8
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 98.8
PRK08058329 DNA polymerase III subunit delta'; Validated 98.8
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 98.77
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.77
PRK04195482 replication factor C large subunit; Provisional 98.76
PRK14086617 dnaA chromosomal replication initiation protein; P 98.76
TIGR02974329 phageshock_pspF psp operon transcriptional activat 98.76
TIGR01817534 nifA Nif-specific regulatory protein. This model r 98.75
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.74
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.74
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.74
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 98.73
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.71
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.71
PRK05707328 DNA polymerase III subunit delta'; Validated 98.7
PRK11608326 pspF phage shock protein operon transcriptional ac 98.7
KOG00081563 consensus Transcription initiation factor TFIID, s 98.7
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 98.7
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.69
PRK13342413 recombination factor protein RarA; Reviewed 98.68
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 98.68
COG3829560 RocR Transcriptional regulator containing PAS, AAA 98.68
PRK14088440 dnaA chromosomal replication initiation protein; P 98.68
COG1221403 PspF Transcriptional regulators containing an AAA- 98.67
PRK00149450 dnaA chromosomal replication initiation protein; R 98.66
PRK08084235 DNA replication initiation factor; Provisional 98.66
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 98.65
PRK15424538 propionate catabolism operon regulatory protein Pr 98.65
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 98.65
TIGR02329526 propionate_PrpR propionate catabolism operon regul 98.64
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 98.63
PRK12422445 chromosomal replication initiation protein; Provis 98.63
PRK05022509 anaerobic nitric oxide reductase transcription reg 98.62
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.62
PF07726131 AAA_3: ATPase family associated with various cellu 98.62
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 98.62
PTZ001121164 origin recognition complex 1 protein; Provisional 98.61
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 98.61
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.61
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 98.6
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.6
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.59
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.59
KOG2028554 consensus ATPase related to the helicase subunit o 98.59
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.59
PHA02544316 44 clamp loader, small subunit; Provisional 98.58
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.58
PRK08727233 hypothetical protein; Validated 98.58
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.58
PRK14087450 dnaA chromosomal replication initiation protein; P 98.58
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.57
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 98.57
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.57
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.56
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.56
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.55
PLN03025319 replication factor C subunit; Provisional 98.55
PRK05642234 DNA replication initiation factor; Validated 98.54
PRK13341 725 recombination factor protein RarA/unknown domain f 98.54
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 98.53
smart00382148 AAA ATPases associated with a variety of cellular 98.53
PRK07993334 DNA polymerase III subunit delta'; Validated 98.52
COG2204464 AtoC Response regulator containing CheY-like recei 98.52
PRK06871325 DNA polymerase III subunit delta'; Validated 98.51
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.51
PRK08116268 hypothetical protein; Validated 98.51
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.51
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.51
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.51
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.49
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.49
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 98.49
COG3829560 RocR Transcriptional regulator containing PAS, AAA 98.49
PRK06620214 hypothetical protein; Validated 98.48
PRK08769319 DNA polymerase III subunit delta'; Validated 98.48
PRK06964342 DNA polymerase III subunit delta'; Validated 98.48
smart00350509 MCM minichromosome maintenance proteins. 98.46
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 98.46
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.45
COG2204464 AtoC Response regulator containing CheY-like recei 98.45
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.44
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 98.43
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 98.42
PRK07940394 DNA polymerase III subunit delta'; Validated 98.42
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.42
COG0714329 MoxR-like ATPases [General function prediction onl 98.42
PRK12402337 replication factor C small subunit 2; Reviewed 98.41
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.4
KOG1969877 consensus DNA replication checkpoint protein CHL12 98.39
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.39
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 98.39
PRK06526254 transposase; Provisional 98.39
KOG1472 720 consensus Histone acetyltransferase SAGA/ADA, cata 98.37
PRK08181269 transposase; Validated 98.37
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.37
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 98.37
PRK12377248 putative replication protein; Provisional 98.36
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.36
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 98.35
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.35
PRK06090319 DNA polymerase III subunit delta'; Validated 98.34
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 98.34
COG0593408 DnaA ATPase involved in DNA replication initiation 98.33
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.33
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.32
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 98.32
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 98.32
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.32
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.31
PRK07952244 DNA replication protein DnaC; Validated 98.31
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 98.31
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.3
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.29
PRK09862506 putative ATP-dependent protease; Provisional 98.29
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 98.29
PRK09087226 hypothetical protein; Validated 98.29
PHA02244383 ATPase-like protein 98.28
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 98.28
PRK08699325 DNA polymerase III subunit delta'; Validated 98.28
PRK09183259 transposase/IS protein; Provisional 98.27
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 98.27
PRK06921266 hypothetical protein; Provisional 98.26
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 98.26
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 98.26
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 98.26
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.25
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.25
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.25
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 98.24
PRK06835329 DNA replication protein DnaC; Validated 98.23
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 98.23
TIGR02974329 phageshock_pspF psp operon transcriptional activat 98.22
PRK08939306 primosomal protein DnaI; Reviewed 98.21
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.21
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 98.21
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.19
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.18
PRK13407334 bchI magnesium chelatase subunit I; Provisional 98.18
PRK13765637 ATP-dependent protease Lon; Provisional 98.18
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 98.16
KOG00081563 consensus Transcription initiation factor TFIID, s 98.16
COG1221403 PspF Transcriptional regulators containing an AAA- 98.16
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 98.15
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.15
KOG1828418 consensus IRF-2-binding protein CELTIX-1, contains 98.15
PRK11608326 pspF phage shock protein operon transcriptional ac 98.15
PRK13531498 regulatory ATPase RavA; Provisional 98.15
PRK08116268 hypothetical protein; Validated 98.15
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 98.15
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.14
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 98.14
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 98.13
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.13
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 98.13
TIGR02329526 propionate_PrpR propionate catabolism operon regul 98.13
PRK00440319 rfc replication factor C small subunit; Reviewed 98.12
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.12
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 98.11
TIGR01817534 nifA Nif-specific regulatory protein. This model r 98.11
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 98.11
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.11
PRK08181269 transposase; Validated 98.11
PF13173128 AAA_14: AAA domain 98.11
PF05729166 NACHT: NACHT domain 98.08
PRK05022509 anaerobic nitric oxide reductase transcription reg 98.08
KOG1827 629 consensus Chromatin remodeling complex RSC, subuni 98.07
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.06
PRK15424538 propionate catabolism operon regulatory protein Pr 98.05
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.05
PRK15115444 response regulator GlrR; Provisional 98.03
PRK09302509 circadian clock protein KaiC; Reviewed 98.03
PRK05917290 DNA polymerase III subunit delta'; Validated 98.01
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.01
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.0
PRK06526254 transposase; Provisional 98.0
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 98.0
PRK05707328 DNA polymerase III subunit delta'; Validated 97.98
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 97.97
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 97.97
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.96
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 97.96
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 97.95
PTZ00111915 DNA replication licensing factor MCM4; Provisional 97.95
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 97.94
COG0470325 HolB ATPase involved in DNA replication [DNA repli 97.93
PRK12377248 putative replication protein; Provisional 97.93
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 97.9
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.89
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 97.88
KOG2170344 consensus ATPase of the AAA+ superfamily [General 97.88
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 97.87
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 97.87
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 97.87
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 97.86
PRK09183259 transposase/IS protein; Provisional 97.85
PRK08939306 primosomal protein DnaI; Reviewed 97.85
PF07726131 AAA_3: ATPase family associated with various cellu 97.84
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.83
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 97.83
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.83
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 97.82
PRK06921266 hypothetical protein; Provisional 97.81
KOG1474 640 consensus Transcription initiation factor TFIID, s 97.81
PRK07952244 DNA replication protein DnaC; Validated 97.78
smart00350509 MCM minichromosome maintenance proteins. 97.76
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 97.75
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 97.75
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 97.75
PRK06835329 DNA replication protein DnaC; Validated 97.74
PRK13406584 bchD magnesium chelatase subunit D; Provisional 97.74
PRK10365441 transcriptional regulatory protein ZraR; Provision 97.72
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 97.71
PRK07132299 DNA polymerase III subunit delta'; Validated 97.69
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 97.69
KOG2228408 consensus Origin recognition complex, subunit 4 [R 97.68
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 97.68
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 97.68
PRK07276290 DNA polymerase III subunit delta'; Validated 97.67
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.66
PF13173128 AAA_14: AAA domain 97.65
PRK05564313 DNA polymerase III subunit delta'; Validated 97.65
KOG0478804 consensus DNA replication licensing factor, MCM4 c 97.65
PRK15115444 response regulator GlrR; Provisional 97.64
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 97.63
PRK06964342 DNA polymerase III subunit delta'; Validated 97.63
PRK07471365 DNA polymerase III subunit delta'; Validated 97.63
PHA00729226 NTP-binding motif containing protein 97.62
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.62
PRK06851367 hypothetical protein; Provisional 97.6
PRK05818261 DNA polymerase III subunit delta'; Validated 97.59
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.59
COG3283511 TyrR Transcriptional regulator of aromatic amino a 97.58
PRK09112351 DNA polymerase III subunit delta'; Validated 97.58
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.57
PRK08058329 DNA polymerase III subunit delta'; Validated 97.53
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.51
PRK10365441 transcriptional regulatory protein ZraR; Provision 97.5
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=4.7e-83  Score=729.33  Aligned_cols=492  Identities=32%  Similarity=0.502  Sum_probs=444.2

Q ss_pred             ccccccccCChhHHHHHhhhhhcccccccccccccccCCCcceeeecCCCChhHHHHHHHHhhhhhcCCeEEEEEecchh
Q 000973          374 ESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGAD  453 (1205)
Q Consensus       374 ~~~~~~~i~Gl~~~k~~L~e~v~~pl~~~~~~~~~g~~~~~~vLL~GppGtGKT~laralA~~l~~~~~~~~~~~i~~~~  453 (1205)
                      ++++|.+|||++.++.+|.+++.. +.+|+.|..+|+.||+|||||||||||||+||+|||.+++     ++|+.+++.+
T Consensus       185 snv~f~diGG~d~~~~el~~li~~-i~~Pe~~~~lGv~PprGvLlHGPPGCGKT~lA~AiAgel~-----vPf~~isApe  258 (802)
T KOG0733|consen  185 SNVSFSDIGGLDKTLAELCELIIH-IKHPEVFSSLGVRPPRGVLLHGPPGCGKTSLANAIAGELG-----VPFLSISAPE  258 (802)
T ss_pred             CCcchhhccChHHHHHHHHHHHHH-hcCchhHhhcCCCCCCceeeeCCCCccHHHHHHHHhhhcC-----CceEeecchh
Confidence            367999999999999999999988 9999999999999999999999999999999999999996     9999999999


Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhcCCceEEEeccCCcccccchhhhHHHHHHHHHHHHHhhCcccC----CcEEEEccccc
Q 000973          454 VLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSR----GQVVLIGATNR  529 (1205)
Q Consensus       454 l~~~~~g~~e~~l~~lf~~a~~~~p~VL~IDEid~L~~~r~~~~~~~~~~v~~~Ll~~ld~~~~~----~~viVI~atn~  529 (1205)
                      +++.+.|++++.++.+|++|....||||||||||++.|+|...+..+..+++.|||..||++...    ..|+||||||+
T Consensus       259 ivSGvSGESEkkiRelF~~A~~~aPcivFiDeIDAI~pkRe~aqreMErRiVaQLlt~mD~l~~~~~~g~~VlVIgATnR  338 (802)
T KOG0733|consen  259 IVSGVSGESEKKIRELFDQAKSNAPCIVFIDEIDAITPKREEAQREMERRIVAQLLTSMDELSNEKTKGDPVLVIGATNR  338 (802)
T ss_pred             hhcccCcccHHHHHHHHHHHhccCCeEEEeecccccccchhhHHHHHHHHHHHHHHHhhhcccccccCCCCeEEEecCCC
Confidence            99999999999999999999999999999999999999999999999999999999999998654    57999999999


Q ss_pred             cccccccccCCCCccccccCCCCCchhhhhhhhccccccCCCCchhHHHHHhhhhhcccchhHHHHhHHHHHHHHHHhCC
Q 000973          530 VDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYP  609 (1205)
Q Consensus       530 ~~~ld~aL~r~gRf~~~I~~~~P~~eer~~Il~~~l~~~~~~~~~~~l~~LA~~t~G~sgadI~~L~~eA~~~a~rr~~~  609 (1205)
                      |+.||++|+|+|||++.|.+..|+..+|.+||+.+++++.+...-+. ..||..|.||+|+||.+||.+|+..|+.|...
T Consensus       339 PDslDpaLRRaGRFdrEI~l~vP~e~aR~~IL~~~~~~lrl~g~~d~-~qlA~lTPGfVGADL~AL~~~Aa~vAikR~ld  417 (802)
T KOG0733|consen  339 PDSLDPALRRAGRFDREICLGVPSETAREEILRIICRGLRLSGDFDF-KQLAKLTPGFVGADLMALCREAAFVAIKRILD  417 (802)
T ss_pred             CcccCHHHhccccccceeeecCCchHHHHHHHHHHHhhCCCCCCcCH-HHHHhcCCCccchhHHHHHHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999888775554 79999999999999999999999999998765


Q ss_pred             ceec-------c-C--------CceEE----------e--------------------ccceeeeehhhhhhhcccCccc
Q 000973          610 QVYT-------S-D--------DKFLI----------D--------------------VDSVTVEKYHFIEAMSTITPAA  643 (1205)
Q Consensus       610 ~i~~-------~-~--------~~~~~----------d--------------------~~~~~It~~df~~al~~i~ps~  643 (1205)
                      ....       + +        ++..+          +                    .....|+.+||..|+..++|++
T Consensus       418 ~~~~p~~~~~~~ed~~~~~~~~d~S~i~~~~~~~~~~~ld~v~~~~i~~~~d~~S~E~~~~L~i~~eDF~~Al~~iQPSa  497 (802)
T KOG0733|consen  418 QSSSPLTKVPISEDSSNKDAEEDQSSIKITSNAERPLELDRVVQDAILNNPDPLSKELLEGLSIKFEDFEEALSKIQPSA  497 (802)
T ss_pred             cccCccccCCccccccCCCccchhhhhhcCCcccccccHHHHHHHHHHhCCCCcChHHhccceecHHHHHHHHHhcCcch
Confidence            3331       0 0        00000          0                    0123578899999999999999


Q ss_pred             cccceecccccchhhhhHHHHHHHHHhhhhhhcCCCCccchhhhhhhhcccCCcccccccceeeeecCCCCCCCccchhh
Q 000973          644 HRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSEGTGVDHLGPAI  723 (1205)
Q Consensus       644 ~r~~~~~~~~~~~~~i~~l~~~L~~~~~~l~~i~p~~~~~~~~~~l~~~~~G~~~P~~~~~~lLl~GppGtGKT~lA~al  723 (1205)
                      .|......+.+.|.++++|++.-.++..+   |..++++++.|+++|+.         .|.|+|||||||||||+||||+
T Consensus       498 kREGF~tVPdVtW~dIGaL~~vR~eL~~a---I~~PiK~pd~~k~lGi~---------~PsGvLL~GPPGCGKTLlAKAV  565 (802)
T KOG0733|consen  498 KREGFATVPDVTWDDIGALEEVRLELNMA---ILAPIKRPDLFKALGID---------APSGVLLCGPPGCGKTLLAKAV  565 (802)
T ss_pred             hcccceecCCCChhhcccHHHHHHHHHHH---HhhhccCHHHHHHhCCC---------CCCceEEeCCCCccHHHHHHHH
Confidence            99999999999999999998877766655   44578889999998753         2469999999999999999999


Q ss_pred             hhhcccCccccCCCccccCCCCCCChhhHHHHhhccccccCCceeeeccchhhHHh-------HHHHHHHHHHHHHHhcC
Q 000973          724 LHELEKFPVHSLGLPALLSDPSAKTPEEALVHIFGEARRTTPSILYIPQFNLWWEN-------AHEQLRAVLLTLLEELP  796 (1205)
Q Consensus       724 a~~l~~~~~~~l~~~~l~~~~~~g~se~~~~~lf~~A~~~~p~ILfiDEid~l~~~-------~~~~~~~~ll~lL~~~~  796 (1205)
                      |++. +++|+++.+++|+.+| +|++|.+++++|..|+..+||||||||||+|.+.       ++.+++++||+.||+++
T Consensus       566 ANEa-g~NFisVKGPELlNkY-VGESErAVR~vFqRAR~saPCVIFFDEiDaL~p~R~~~~s~~s~RvvNqLLtElDGl~  643 (802)
T KOG0733|consen  566 ANEA-GANFISVKGPELLNKY-VGESERAVRQVFQRARASAPCVIFFDEIDALVPRRSDEGSSVSSRVVNQLLTELDGLE  643 (802)
T ss_pred             hhhc-cCceEeecCHHHHHHH-hhhHHHHHHHHHHHhhcCCCeEEEecchhhcCcccCCCCchhHHHHHHHHHHHhcccc
Confidence            9998 9999999999999998 8999999999999999999999999999999843       78899999999999999


Q ss_pred             CCCCeEEeccCCcCCccccCCCccccCCC--ceeeecCCCccchhhhHHHHHHHHHHHhhccCCCCCCCCCCCCCCCCCC
Q 000973          797 SHLPILLLGSSSVPLAEVEGDPSTVFPLR--SVYQVEKPSTEDRSLFLGRLIEAAVSVVLEGRSKKPQESVSLPELPKVP  874 (1205)
Q Consensus       797 ~~~~v~vIattn~~~~~Ld~~~~~~f~~r--~ii~~~~P~~~eR~~i~~~~l~~~~~~~~~~~~~~~~~~~~l~~Lp~~~  874 (1205)
                      .+.+|+|||+||+| +.+|+  +.+|+||  .+++|++|+.++|..|++.+.++.        ..+...+++|++|+..+
T Consensus       644 ~R~gV~viaATNRP-DiIDp--AiLRPGRlDk~LyV~lPn~~eR~~ILK~~tkn~--------k~pl~~dVdl~eia~~~  712 (802)
T KOG0733|consen  644 ERRGVYVIAATNRP-DIIDP--AILRPGRLDKLLYVGLPNAEERVAILKTITKNT--------KPPLSSDVDLDEIARNT  712 (802)
T ss_pred             cccceEEEeecCCC-cccch--hhcCCCccCceeeecCCCHHHHHHHHHHHhccC--------CCCCCcccCHHHHhhcc
Confidence            99999999999999 99999  8899988  899999999999999999999751        23557889999999873


Q ss_pred             CccCCCchhhhhHhH-HHHHHHHHH
Q 000973          875 TVESGPKASELKAKV-EAEQHALRR  898 (1205)
Q Consensus       875 ~~~~g~S~aELk~~~-ea~~~alre  898 (1205)
                       ...||+||+|.+++ ++...++++
T Consensus       713 -~c~gftGADLaaLvreAsi~AL~~  736 (802)
T KOG0733|consen  713 -KCEGFTGADLAALVREASILALRE  736 (802)
T ss_pred             -cccCCchhhHHHHHHHHHHHHHHH
Confidence             24599999999999 999999887

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1205
3cf1_A806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 1e-60
1r7r_A816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 2e-60
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 3e-58
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 3e-58
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 3e-58
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 3e-56
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 2e-46
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 9e-46
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 1e-44
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 3e-44
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 7e-43
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 4e-42
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 7e-40
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 7e-39
2ce7_A476 Edta Treated Length = 476 1e-38
3kds_E465 Apo-ftsh Crystal Structure Length = 465 5e-38
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 2e-36
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 2e-36
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 3e-36
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 5e-36
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 5e-36
1xwi_A322 Crystal Structure Of Vps4b Length = 322 1e-35
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 1e-35
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 2e-35
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 4e-34
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 4e-33
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 9e-33
3vfd_A389 Human Spastin Aaa Domain Length = 389 9e-33
4eiw_A508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 4e-29
2dhr_A499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 4e-29
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 7e-29
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 8e-29
3b9p_A297 Spastin Length = 297 7e-28
3lxj_A136 Crystal Structure Of The Bromodomain Of Human Aaa D 2e-20
2dkw_A131 Solution Structure Of The Bromodomain Of Human Prot 3e-18
3dai_A130 Crystal Structure Of The Bromodomain Of The Human A 1e-17
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 2e-08
3uv4_A158 Crystal Structure Of The Second Bromodomain Of Huma 2e-08
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 7e-08
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 7e-08
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 2e-07
3hmh_A155 Crystal Structure Of The Second Bromodomain Of Huma 2e-07
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 2e-07
3q2e_A123 Crystal Structure Of The Second Bromodomain Of Huma 5e-07
3d7c_A112 Crystal Structure Of The Bromodomain Of Human Gcn5, 1e-06
3rcw_A135 Crystal Structure Of The Bromodomain Of Human Brd1 1e-06
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 2e-06
3hmf_A116 Crystal Structure Of The Second Bromodomain Of Huma 2e-06
3ljw_A120 Crystal Structure Of The Second Bromodomain Of Huma 2e-06
2ktb_B121 Solution Structure Of The Second Bromodomain Of Hum 2e-06
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 3e-06
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 3e-06
1f68_A103 Nmr Solution Structure Of The Bromodomain From Huma 3e-06
3nxb_A116 Crystal Structure Of The Bromodomain Of Human Cecr2 4e-06
3hme_A123 Crystal Structure Of Human Bromodomain Containing 9 4e-06
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 6e-06
2nxb_A123 Crystal Structure Of Human Bromodomain Containing P 6e-06
1e6i_A121 Bromodomain From Gcn5 Complexed With Acetylated H4 7e-06
3mb3_A135 Crystal Structure Of The Second Bromodomain Of Plec 7e-06
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 1e-05
1n72_A118 Structure And Ligand Of A Histone Acetyltransferase 1e-05
3gg3_A119 Crystal Structure Of The Bromodomain Of Human Pcaf 2e-05
2i7k_A117 Solution Structure Of The Bromodomain Of Human Brd7 2e-05
2e7o_A112 Solution Structure Of The Bromodomain From Human Br 2e-05
3g0l_A117 Crystal Structure Of Human Bromodomain Adjacent To 4e-05
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 5e-05
3i3j_A124 Crystal Structure Of The Bromodomain Of Human Ep300 6e-05
2e7n_A117 Solution Structure Of The Second Bromodomain From H 6e-05
2oo1_A113 Crystal Structure Of The Bromo Domain 2 Of Human Br 7e-05
2d9e_A121 Solution Structure Of The Bromodomain Of Peregrin L 9e-05
2rfj_A119 Crystal Structure Of The Bromo Domain 1 In Human Br 9e-05
1jsp_B121 Nmr Structure Of Cbp Bromodomain In Complex With P5 2e-04
3dwy_A119 Crystal Structure Of The Bromodomain Of Human Crebb 2e-04
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 3e-04
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 3e-04
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 4e-04
2krk_A86 Solution Nmr Structure Of 26s Protease Regulatory S 4e-04
2wp1_A126 Structure Of Brdt Bromodomain 2 Bound To An Acetyla 5e-04
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 5e-04
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 5e-04
4don_A145 Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy 8e-04
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure 
Iteration: 1

 Score =  232 bits (591), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 151/404 (37%), Positives = 221/404 (54%), Gaps = 29/404 (7%)
Query: 376 VSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALAC 435
           V +DDIGG  + +  +KEMV  PL +P  F +  + PPRG+LL GPPGTGKTLIARA+A 
Sbjct: 201 VGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVA- 259
Query: 436 AASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSS 495
             ++ G    F++  G +++SK  GE+E  L+  FEEA++N P+IIF DE+D +AP R  
Sbjct: 260 --NETG--AFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREK 315
Query: 496 KQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCE 555
              ++   IVS LL LMDGL  R  V+++ ATNR ++ID ALRR GRFDRE +  +P   
Sbjct: 316 THGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDAT 375
Query: 556 ARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSD 615
            R EIL IHT+  K     +L+ ++A    G+ GADL ALC+EAA++A R+K   +   D
Sbjct: 376 GRLEILQIHTKNMKLADDVDLE-QVANETHGHVGADLAALCSEAALQAIRKKMDLIDLED 434
Query: 616 DKFLIDV-DSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQ---RHLQKAMN 671
           +    +V +S+ V    F  A+S   P+A R   V    ++      L+   R LQ+ + 
Sbjct: 435 ETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQ 494
Query: 672 YISDIFPPLGMSSELTKLCML-SHGSAIPLVYRPRLLLCGSEGTGVDHLGPAILHELEKF 730
           Y      P+    +  K  M  S G          +L  G  G G   L  AI +E +  
Sbjct: 495 Y------PVEHPDKFLKFGMTPSKG----------VLFYGPPGCGKTLLAKAIANECQAN 538
Query: 731 PVHSLGLPALLSDPSAKTPEEALVHIFGEARRTTPSILYIPQFN 774
            +   G P LL+    ++ E  +  IF +AR+  P +L+  + +
Sbjct: 539 FISIKG-PELLTMWFGES-EANVREIFDKARQAAPCVLFFDELD 580
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 Back     alignment and structure
>pdb|2DKW|A Chain A, Solution Structure Of The Bromodomain Of Human Protein Kiaa1240 Length = 131 Back     alignment and structure
>pdb|3DAI|A Chain A, Crystal Structure Of The Bromodomain Of The Human Atad2 Length = 130 Back     alignment and structure
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 Back     alignment and structure
>pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 Back     alignment and structure
>pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 Back     alignment and structure
>pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 Back     alignment and structure
>pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 Back     alignment and structure
>pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 Back     alignment and structure
>pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 Back     alignment and structure
>pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 Back     alignment and structure
>pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 Back     alignment and structure
>pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 Back     alignment and structure
>pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 Back     alignment and structure
>pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 Back     alignment and structure
>pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 Back     alignment and structure
>pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 Back     alignment and structure
>pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 Back     alignment and structure
>pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 Back     alignment and structure
>pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 Back     alignment and structure
>pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|2KRK|A Chain A, Solution Nmr Structure Of 26s Protease Regulatory Subunit 8 From H.Sapiens, Northeast Structural Genomics Consortium Target Target Hr3102a Length = 86 Back     alignment and structure
>pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1205
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 1e-117
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 4e-90
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 2e-89
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 1e-86
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-85
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 9e-85
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 4e-76
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 2e-72
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 3e-72
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 6e-72
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 8e-72
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 1e-67
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 1e-67
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 2e-53
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 6e-53
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 6e-52
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 6e-52
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-51
2r62_A268 Cell division protease FTSH homolog; ATPase domain 3e-50
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 7e-50
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 3e-46
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 4e-46
3dai_A130 ATPase family AAA domain-containing protein 2; anc 9e-44
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 4e-37
3rcw_A135 Bromodomain-containing protein 1; transcription, s 7e-24
2d9e_A121 Peregrin; four-helix bundle, transcription activat 5e-23
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 6e-23
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 1e-21
3uv4_A158 Second bromodomain of human transcription initiat 4e-21
3d7c_A112 General control of amino acid synthesis protein 5; 8e-20
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 9e-20
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 1e-19
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 2e-19
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 1e-15
3nxb_A116 CAT eye syndrome critical region protein 2; struct 4e-19
3aad_A292 Transcription initiation factor TFIID subunit 1; p 8e-19
3aad_A292 Transcription initiation factor TFIID subunit 1; p 2e-16
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 9e-19
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 1e-18
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 1e-18
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 4e-18
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 5e-18
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 9e-18
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-17
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-17
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 2e-17
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 2e-17
2dat_A123 Possible global transcription activator SNF2L2; br 2e-17
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 2e-17
4alg_A154 Bromodomain-containing protein 2; signaling protei 3e-17
2grc_A129 Probable global transcription activator SNF2L4; br 4e-17
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 6e-17
3fkm_X166 Signaling protein; bromodomain, malaria, structura 8e-17
3p1f_A119 CREB-binding protein; structural genomics consorti 1e-16
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 1e-16
2r0y_A311 Chromatin structure-remodeling complex protein RSC 4e-16
2r0y_A311 Chromatin structure-remodeling complex protein RSC 1e-13
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 8e-16
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 9e-16
2r10_A361 Chromatin structure-remodeling complex protein RSC 3e-15
2r10_A361 Chromatin structure-remodeling complex protein RSC 8e-14
2krk_A86 26S protease regulatory subunit 8; structural geno 1e-14
3kw6_A78 26S protease regulatory subunit 8; structural geno 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 2e-11
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 5e-11
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 1e-09
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 2e-09
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 3e-09
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 3e-09
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 2e-08
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 2e-07
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 3e-07
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 6e-06
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 7e-06
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 5e-05
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 5e-05
3pvs_A447 Replication-associated recombination protein A; ma 7e-05
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 1e-04
2v1u_A387 Cell division control protein 6 homolog; DNA repli 1e-04
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 1e-04
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 2e-04
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 3e-04
3cx5_F146 Cytochrome B-C1 complex subunit 6; complex III, el 4e-04
2qgz_A308 Helicase loader, putative primosome component; str 5e-04
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 9e-04
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
 Score =  371 bits (955), Expect = e-117
 Identities = 120/282 (42%), Positives = 168/282 (59%), Gaps = 7/282 (2%)

Query: 365 ADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGT 424
                 +    V +DDIGG  + +  +KEMV  PL +P  F +  + PPRG+LL GPPGT
Sbjct: 190 KREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGT 249

Query: 425 GKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFD 484
           GKTLIARA+A           F++  G +++SK  GE+E  L+  FEEA++N P+IIF D
Sbjct: 250 GKTLIARAVANETG-----AFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFID 304

Query: 485 EIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFD 544
           E+D +AP R     ++   IVS LL LMDGL  R  V+++ ATNR ++ID ALRR GRFD
Sbjct: 305 ELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFD 364

Query: 545 REFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAF 604
           RE +  +P    R EIL IHT+  K     +L+ ++A    G+ GADL ALC+EAA++A 
Sbjct: 365 REVDIGIPDATGRLEILQIHTKNMKLADDVDLE-QVANETHGHVGADLAALCSEAALQAI 423

Query: 605 REKYPQVYTSDDKFLIDV-DSVTVEKYHFIEAMSTITPAAHR 645
           R+K   +   D+    +V +S+ V    F  A+S   P+A R
Sbjct: 424 RKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALR 465
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Length = 412 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Length = 387 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Length = 525 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Length = 377 Back     alignment and structure
>3cx5_F Cytochrome B-C1 complex subunit 6; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: f.28.1.1 PDB: 3cxh_F* 1ezv_H* 1kb9_F* 1p84_F* 2ibz_H* 1kyo_F* Length = 146 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Length = 310 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1205
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 100.0
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 100.0
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 100.0
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 100.0
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 100.0
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 100.0
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 100.0
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.98
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.98
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.97
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.97
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.97
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.97
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.97
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.97
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.97
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.97
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.97
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.96
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.96
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.96
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 99.96
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.96
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.96
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.95
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.95
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.95
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.95
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.95
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.95
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.95
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.94
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.94
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.93
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.92
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.89
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.88
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.87
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.86
3d7c_A112 General control of amino acid synthesis protein 5; 99.86
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.85
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.85
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.85
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.85
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.85
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.85
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.85
2dat_A123 Possible global transcription activator SNF2L2; br 99.84
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.84
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.84
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.84
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.84
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.83
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.83
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.83
3uv4_A158 Second bromodomain of human transcription initiat 99.83
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.83
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.83
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.83
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.82
2grc_A129 Probable global transcription activator SNF2L4; br 99.82
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.82
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.82
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.82
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.82
3p1f_A119 CREB-binding protein; structural genomics consorti 99.82
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 99.82
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.81
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.81
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.81
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.8
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.8
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.79
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.78
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.78
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.78
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.78
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.78
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.77
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.76
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.74
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.74
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.74
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.74
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.74
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.74
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.73
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.73
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.72
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.72
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.71
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.71
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.71
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.7
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.69
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 99.68
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.66
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.66
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.65
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.65
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.64
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.64
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.64
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.62
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 99.61
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.61
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.6
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.59
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.58
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.57
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.57
3bos_A242 Putative DNA replication factor; P-loop containing 99.57
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.56
3pvs_A447 Replication-associated recombination protein A; ma 99.56
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.56
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.54
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.54
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.54
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.53
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.53
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 99.52
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.52
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.51
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.49
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.49
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.49
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.49
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.48
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.48
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.47
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.46
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.45
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.43
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.43
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.43
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.39
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.38
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.38
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.37
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.37
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.36
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.36
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.36
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.35
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.34
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 99.28
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.27
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.25
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.2
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.2
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.18
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.17
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.13
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.13
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.13
3co5_A143 Putative two-component system transcriptional RES 99.11
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.11
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.09
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.09
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.08
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.07
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 99.06
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.03
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.03
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 98.99
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.98
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 98.98
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.97
2gno_A305 DNA polymerase III, gamma subunit-related protein; 98.95
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 98.95
3co5_A143 Putative two-component system transcriptional RES 98.93
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.92
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 98.91
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.9
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 98.89
3pvs_A447 Replication-associated recombination protein A; ma 98.89
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 98.89
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 98.88
2v1u_A387 Cell division control protein 6 homolog; DNA repli 98.87
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.81
1ojl_A304 Transcriptional regulatory protein ZRAR; response 98.8
3bos_A242 Putative DNA replication factor; P-loop containing 98.77
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 98.74
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.74
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 98.71
2r44_A331 Uncharacterized protein; putative ATPase, structur 98.7
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 98.68
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 98.68
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.65
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.65
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 98.65
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 98.61
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.59
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.54
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.51
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 98.51
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.5
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.5
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 98.49
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.47
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 98.47
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 98.46
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 98.45
3f8t_A506 Predicted ATPase involved in replication control, 98.45
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.43
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 98.43
2krk_A86 26S protease regulatory subunit 8; structural geno 98.42
2fna_A357 Conserved hypothetical protein; structural genomic 98.41
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.4
3kw6_A78 26S protease regulatory subunit 8; structural geno 98.38
2gno_A305 DNA polymerase III, gamma subunit-related protein; 98.36
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.32
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 98.31
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.31
2qgz_A308 Helicase loader, putative primosome component; str 98.24
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 98.24
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.13
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.05
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 98.04
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.03
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 98.03
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 98.01
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 97.97
1tue_A212 Replication protein E1; helicase, replication, E1E 97.97
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 97.96
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 97.96
2qgz_A308 Helicase loader, putative primosome component; str 97.89
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.89
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 97.76
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 97.68
1tue_A212 Replication protein E1; helicase, replication, E1E 97.65
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.64
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.58
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.51
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.51
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.49
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.49
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 97.45
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.43
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.42
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.35
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.31
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.23
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.17
2z43_A324 DNA repair and recombination protein RADA; archaea 97.13
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.12
2fna_A357 Conserved hypothetical protein; structural genomic 97.1
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.1
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.08
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.05
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.03
3io5_A333 Recombination and repair protein; storage dimer, i 96.98
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.91
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.91
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.9
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.83
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.81
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.79
2r6a_A454 DNAB helicase, replicative helicase; replication, 96.76
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.75
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 96.65
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.62
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 96.56
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 96.53
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 96.52
2eyu_A261 Twitching motility protein PILT; pilus retraction 96.51
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.51
3kw6_A78 26S protease regulatory subunit 8; structural geno 96.5
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 96.49
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 96.47
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.41
2krk_A86 26S protease regulatory subunit 8; structural geno 96.4
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.4
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.39
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 96.39
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 96.38
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 96.37
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.37
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 96.33
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 96.32
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.25
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 96.21
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.19
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 96.16
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.12
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.12
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 96.12
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.06
3vaa_A199 Shikimate kinase, SK; structural genomics, center 96.05
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 96.0
3f8t_A506 Predicted ATPase involved in replication control, 95.95
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 95.93
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.92
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 95.9
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.89
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 95.87
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 95.86
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 95.85
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 95.85
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 95.83
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 95.82
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.82
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 95.82
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.78
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 95.77
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 95.76
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 95.76
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 95.72
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 95.7
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 95.62
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 95.6
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 95.59
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 95.58
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 95.57
1xp8_A366 RECA protein, recombinase A; recombination, radior 95.57
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 95.54
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 95.52
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 95.52
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 95.51
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 95.5
1via_A175 Shikimate kinase; structural genomics, transferase 95.48
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 95.44
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 95.43
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.43
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.42
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 95.42
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 95.41
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.4
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 95.39
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 95.39
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 95.38
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 95.38
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 95.37
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 95.34
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 95.32
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.31
3bor_A237 Human initiation factor 4A-II; translation initiat 95.28
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.27
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 95.25
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 95.24
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 95.23
3b6e_A216 Interferon-induced helicase C domain-containing P; 95.21
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 95.2
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.19
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 95.18
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 95.18
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.16
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 95.16
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 95.16
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 95.15
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 95.13
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.13
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 95.12
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 95.11
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 95.11
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 95.09
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 95.08
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 95.07
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 95.06
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 95.04
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 95.01
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 95.01
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 95.0
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 95.0
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.97
4a74_A231 DNA repair and recombination protein RADA; hydrola 94.96
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 94.95
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 94.93
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 94.93
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 94.91
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.9
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 94.89
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 94.88
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 94.87
2z43_A324 DNA repair and recombination protein RADA; archaea 94.85
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 94.84
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 94.83
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 94.82
3vaa_A199 Shikimate kinase, SK; structural genomics, center 94.81
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.8
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 94.8
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 94.78
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.78
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 94.78
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 94.75
2xxa_A433 Signal recognition particle protein; protein trans 94.74
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 94.74
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 94.74
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 94.73
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.72
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 94.72
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 94.72
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 94.7
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 94.7
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 94.68
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.67
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 94.67
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 94.64
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 94.64
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 94.64
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.64
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 94.63
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 94.56
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.56
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.55
2vli_A183 Antibiotic resistance protein; transferase, tunica 94.54
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 94.54
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 94.54
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 94.53
1u94_A356 RECA protein, recombinase A; homologous recombinat 94.53
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 94.53
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 94.52
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 94.52
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.49
3tlx_A243 Adenylate kinase 2; structural genomics, structura 94.49
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.48
1p9r_A418 General secretion pathway protein E; bacterial typ 94.43
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 94.42
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 94.42
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 94.38
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 94.38
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.36
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 94.36
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 94.33
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 94.33
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 94.24
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.24
1via_A175 Shikimate kinase; structural genomics, transferase 94.23
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 94.23
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 94.22
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 94.2
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 94.16
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 94.15
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.11
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 94.1
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 94.09
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 94.08
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 94.08
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 94.06
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 94.06
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 94.05
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 94.05
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 94.02
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 94.01
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 94.0
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 93.97
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 93.96
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 93.95
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 93.94
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 93.94
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 93.92
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 93.9
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 93.88
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.88
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 93.86
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 93.85
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 93.85
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 93.85
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 93.84
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 93.84
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.84
2og2_A359 Putative signal recognition particle receptor; nuc 93.82
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 93.79
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 93.76
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 93.76
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 93.72
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 93.71
2vli_A183 Antibiotic resistance protein; transferase, tunica 93.69
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 93.69
1kag_A173 SKI, shikimate kinase I; transferase, structural g 93.68
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 93.63
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 93.63
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 93.62
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 93.62
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 93.61
3ice_A422 Transcription termination factor RHO; transcriptio 93.58
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 93.56
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 93.55
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 93.55
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 93.53
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 93.52
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 93.52
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 93.51
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 93.51
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 93.47
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 93.47
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.47
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 93.47
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 93.45
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 93.45
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 93.42
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 93.41
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 93.4
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 93.36
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 93.35
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 93.34
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 93.34
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 93.34
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
Probab=100.00  E-value=1.6e-73  Score=714.89  Aligned_cols=490  Identities=33%  Similarity=0.525  Sum_probs=413.4

Q ss_pred             ccccccccCChhHHHHHhhhhhcccccccccccccccCCCcceeeecCCCChhHHHHHHHHhhhhhcCCeEEEEEecchh
Q 000973          374 ESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGAD  453 (1205)
Q Consensus       374 ~~~~~~~i~Gl~~~k~~L~e~v~~pl~~~~~~~~~g~~~~~~vLL~GppGtGKT~laralA~~l~~~~~~~~~~~i~~~~  453 (1205)
                      +.++|+||+|+++++++|+++|.+||.+|++|..+|+.+|+|||||||||||||+||++||++++     ++|+.+++.+
T Consensus       199 ~~v~~~dIgGl~~~~~~l~e~v~~pl~~p~~f~~~g~~~p~GILL~GPPGTGKT~LAraiA~elg-----~~~~~v~~~~  273 (806)
T 3cf2_A          199 NEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG-----AFFFLINGPE  273 (806)
T ss_dssp             SSCCGGGCCSCCTTHHHHHHHHHHHHHCCGGGTSCCCCCCCEEEEECCTTSCHHHHHHHHHTTTT-----CEEEEEEHHH
T ss_pred             CCCChhhhcCHHHHHHHHHHHHHHHccCHHHHhhcCCCCCCeEEEECCCCCCHHHHHHHHHHHhC-----CeEEEEEhHH
Confidence            78999999999999999999999999999999999999999999999999999999999999996     7899999999


Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhcCCceEEEeccCCcccccchhhhHHHHHHHHHHHHHhhCcccCCcEEEEccccccccc
Q 000973          454 VLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAI  533 (1205)
Q Consensus       454 l~~~~~g~~e~~l~~lf~~a~~~~p~VL~IDEid~L~~~r~~~~~~~~~~v~~~Ll~~ld~~~~~~~viVI~atn~~~~l  533 (1205)
                      ++++|+|+++..++.+|..|...+||||||||||.|++++.........+++.+|+.+|+++...++|+||++||+++.|
T Consensus       274 l~sk~~gese~~lr~lF~~A~~~~PsIIfIDEiDal~~~r~~~~~~~~~riv~~LL~~mdg~~~~~~V~VIaaTN~~d~L  353 (806)
T 3cf2_A          274 IMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSI  353 (806)
T ss_dssp             HHSSCTTHHHHHHHHHHHHHTTSCSEEEEEESGGGTCCTTTTCCCTTHHHHHHHHHTHHHHCCGGGCEEEEEECSSTTTS
T ss_pred             hhcccchHHHHHHHHHHHHHHHcCCeEEEEehhcccccccCCCCChHHHHHHHHHHHHHhcccccCCEEEEEecCChhhc
Confidence            99999999999999999999999999999999999999987777777789999999999999988999999999999999


Q ss_pred             cccccCCCCccccccCCCCCchhhhhhhhccccccCCCCchhHHHHHhhhhhcccchhHHHHhHHHHHHHHHHhCCceec
Q 000973          534 DGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVYT  613 (1205)
Q Consensus       534 d~aL~r~gRf~~~I~~~~P~~eer~~Il~~~l~~~~~~~~~~~l~~LA~~t~G~sgadI~~L~~eA~~~a~rr~~~~i~~  613 (1205)
                      |++|+|+|||++.|+|+.|+.++|.+||+.++.++....+.+ +..||..|.||+|+||.++|++|++.|+++....+..
T Consensus       354 D~ALrR~GRFd~~I~i~~Pd~~~R~~IL~~~l~~~~~~~dvd-l~~lA~~T~GfsgaDL~~Lv~eA~~~A~~r~~~~i~~  432 (806)
T 3cf2_A          354 DPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVD-LEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDL  432 (806)
T ss_dssp             CTTTTSTTSSCEEEECCCCCHHHHHHHHHHTCSSSEECTTCC-HHHHHHHCCSCCHHHHHHHHHHHHHHHHHHHHHHGGG
T ss_pred             CHHHhCCcccceEEecCCCCHHHHHHHHHHHhcCCCCCcccC-HHHHHHhcCCCCHHHHHHHHHHHHHHHHHhccccccc
Confidence            999999999999999999999999999999999887665554 4789999999999999999999999999987554433


Q ss_pred             cCCceEE-eccceeeeehhhhhhhcccCccccccceecccccchhhhhHHHHHHHHHhhhhhhcCCCCccchhhhhhhhc
Q 000973          614 SDDKFLI-DVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCML  692 (1205)
Q Consensus       614 ~~~~~~~-d~~~~~It~~df~~al~~i~ps~~r~~~~~~~~~~~~~i~~l~~~L~~~~~~l~~i~p~~~~~~~~~~l~~~  692 (1205)
                      ....... ......|+.+||..|+..+.|+..+......+.+.|.+++++.+..+.+.+.+.   -++.++..|.++++ 
T Consensus       433 ~~~~~~~e~~~~~~v~~~Df~~Al~~~~ps~~r~~~~~~p~v~w~diggl~~~k~~l~e~v~---~p~~~p~~f~~~g~-  508 (806)
T 3cf2_A          433 EDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQ---YPVEHPDKFLKFGM-  508 (806)
T ss_dssp             TCCCCSHHHHHHCEECTTHHHHHHSSSSCCCCCCCCCBCCCCCSTTCCSCHHHHHHHTTTTT---TTTTCSGGGSSSCC-
T ss_pred             cccccchhhhccceeeHHHHHHHHHhCCCcccccccccCCCCCHHHhCCHHHHHHHHHHHHH---hhhhCHHHHHhcCC-
Confidence            3222111 123457999999999999999999999999999999999999888887777642   24556666665542 


Q ss_pred             ccCCcccccccceeeeecCCCCCCCccchhhhhhcccCccccCCCccccCCCCCCChhhHHHHhhccccccCCceeeecc
Q 000973          693 SHGSAIPLVYRPRLLLCGSEGTGVDHLGPAILHELEKFPVHSLGLPALLSDPSAKTPEEALVHIFGEARRTTPSILYIPQ  772 (1205)
Q Consensus       693 ~~G~~~P~~~~~~lLl~GppGtGKT~lA~ala~~l~~~~~~~l~~~~l~~~~~~g~se~~~~~lf~~A~~~~p~ILfiDE  772 (1205)
                              .++.|+||+||||||||++|+|||+++ +.+|+.++.++++++| +|++|++++++|..|+..+||||||||
T Consensus       509 --------~~~~gvLl~GPPGtGKT~lAkaiA~e~-~~~f~~v~~~~l~s~~-vGese~~vr~lF~~Ar~~~P~IifiDE  578 (806)
T 3cf2_A          509 --------TPSKGVLFYGPPGCGKTLLAKAIANEC-QANFISIKGPELLTMW-FGESEANVREIFDKARQAAPCVLFFDE  578 (806)
T ss_dssp             --------CCCSCCEEESSTTSSHHHHHHHHHHTT-TCEEEECCHHHHHTTT-CSSCHHHHHHHHHHHHTTCSEEEECSC
T ss_pred             --------CCCceEEEecCCCCCchHHHHHHHHHh-CCceEEeccchhhccc-cchHHHHHHHHHHHHHHcCCceeechh
Confidence                    235789999999999999999999999 8999999999999998 899999999999999999999999999


Q ss_pred             chhhHHh----------HHHHHHHHHHHHHHhcCCCCCeEEeccCCcCCccccCCCccccCCC--ceeeecCCCccchhh
Q 000973          773 FNLWWEN----------AHEQLRAVLLTLLEELPSHLPILLLGSSSVPLAEVEGDPSTVFPLR--SVYQVEKPSTEDRSL  840 (1205)
Q Consensus       773 id~l~~~----------~~~~~~~~ll~lL~~~~~~~~v~vIattn~~~~~Ld~~~~~~f~~r--~ii~~~~P~~~eR~~  840 (1205)
                      ||+|+..          ...+++++|+++|+++....+|+||||||+| +.||+  +.+|++|  .+|+|++|+.++|.+
T Consensus       579 iDsl~~~R~~~~~~~~~~~~rv~~~lL~~mdg~~~~~~V~vi~aTN~p-~~lD~--AllRpgRfd~~i~v~lPd~~~R~~  655 (806)
T 3cf2_A          579 LDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRP-DIIDP--AILRPGRLDQLIYIPLPDEKSRVA  655 (806)
T ss_dssp             GGGCC--------------CHHHHHHHHHHHSSCSSSSEEEECC-CCS-SSSCH--HHHSTTTSCCEEEC-----CHHHH
T ss_pred             hhHHhhccCCCCCCCchHHHHHHHHHHHHHhCCCCCCCEEEEEeCCCc-hhCCH--hHcCCCcceEEEEECCcCHHHHHH
Confidence            9999843          2357899999999999999999999999998 99999  7777554  889999999999999


Q ss_pred             hHHHHHHHHHHHhhccCCCCCCCCCCCCCCCCCCCccCCCchhhhhHhH-HHHHHHHHHH
Q 000973          841 FLGRLIEAAVSVVLEGRSKKPQESVSLPELPKVPTVESGPKASELKAKV-EAEQHALRRL  899 (1205)
Q Consensus       841 i~~~~l~~~~~~~~~~~~~~~~~~~~l~~Lp~~~~~~~g~S~aELk~~~-ea~~~alrel  899 (1205)
                      ||+.++++.          +...++++..|+..   +.||||++|+++| +|.+.++|+.
T Consensus       656 il~~~l~~~----------~~~~~~dl~~la~~---t~g~SGadi~~l~~~A~~~a~r~~  702 (806)
T 3cf2_A          656 ILKANLRKS----------PVAKDVDLEFLAKM---TNGFSGADLTEICQRACKLAIRES  702 (806)
T ss_dssp             TTTTTSSCC------------CCC-------------------CHHHHHHHHHHHHHHHH
T ss_pred             HHHHHhcCC----------CCCCCCCHHHHHHh---CCCCCHHHHHHHHHHHHHHHHHHH
Confidence            999988642          33566788888877   8899999999999 8989888773
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1205
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 4e-80
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 5e-04
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 2e-79
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 2e-05
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 5e-67
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 1e-57
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 2e-44
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 3e-28
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 2e-25
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 3e-25
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 2e-19
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 4e-18
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 2e-17
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 8e-17
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 8e-17
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 1e-16
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 5e-16
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 2e-15
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 6e-14
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 4e-12
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 6e-10
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 5e-07
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 2e-05
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 4e-05
d1g41a_443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 2e-04
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 4e-04
d1r6bx2268 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, A 7e-04
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 0.001
d1ihua1296 c.37.1.10 (A:1-296) Arsenite-translocating ATPase 0.001
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 0.001
d1sxje2252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 0.002
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 0.003
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

 Score =  261 bits (668), Expect = 4e-80
 Identities = 87/243 (35%), Positives = 128/243 (52%), Gaps = 10/243 (4%)

Query: 376 VSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALAC 435
            +F D+ G  E  + + E+V + L  P  F       P+GVL+ GPPGTGKTL+A+A+A 
Sbjct: 9   TTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAG 67

Query: 436 AASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSS 495
            A     KV F+   G+D +  +VG    +++ +FE+A++  P IIF DEID +   R +
Sbjct: 68  EA-----KVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGA 122

Query: 496 KQEQIH---NSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLP 552
                H      ++ +L  MDG +    +++I ATNR D +D AL RPGRFDR+    LP
Sbjct: 123 GLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLP 182

Query: 553 GCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVY 612
               R +IL +H R+    P  +    +A    G+ GADL  L  EAA+ A R     V 
Sbjct: 183 DVRGREQILKVHMRRVPLAPDIDAA-IIARGTPGFSGADLANLVNEAALFAARGNKRVVS 241

Query: 613 TSD 615
             +
Sbjct: 242 MVE 244
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 296 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1205
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.94
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.94
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.93
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.91
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.88
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.84
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.83
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.83
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.82
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.81
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.8
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.77
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.76
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.75
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.73
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.7
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.67
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.67
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.63
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.61
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.6
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.59
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.58
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.54
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.52
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.52
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.5
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.49
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.46
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.43
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.31
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.27
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.27
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.25
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.2
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.19
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.16
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.14
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.01
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.01
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.99
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.93
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.87
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.86
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 98.81
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.79
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.75
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.72
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.7
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.66
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.64
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.63
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.58
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 98.58
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.52
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.48
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.48
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.41
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.39
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.34
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.16
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 98.11
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.09
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 97.99
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.97
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.95
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.9
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 97.84
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.38
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.32
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.2
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.19
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.13
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.08
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.03
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.99
d2qy9a2211 GTPase domain of the signal recognition particle r 96.97
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.96
d1okkd2207 GTPase domain of the signal recognition particle r 96.93
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.91
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.9
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.89
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.89
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.89
d1vmaa2213 GTPase domain of the signal recognition particle r 96.85
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.84
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.82
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.8
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.8
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.75
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.72
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.7
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.68
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.66
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.66
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.63
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.63
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.62
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.62
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.62
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.6
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.54
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.52
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.51
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.5
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.5
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.49
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.48
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.46
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.45
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.44
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.43
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.42
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.41
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.39
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.37
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.34
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.33
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.28
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.27
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.26
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.24
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.24
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.15
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.13
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.07
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.07
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.02
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.01
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.01
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.0
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.99
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 95.98
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.98
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.97
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.94
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.85
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 95.84
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.84
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.84
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.82
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.79
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.75
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.7
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.65
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 95.64
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 95.63
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 95.52
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.46
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.46
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.46
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.43
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 95.38
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 95.36
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 95.36
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.33
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.32
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 95.31
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.29
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.26
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.21
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.18
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.15
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.15
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.12
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.09
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.08
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.97
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.94
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.92
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 94.84
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 94.81
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.78
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 94.76
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.74
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.72
d1okkd2207 GTPase domain of the signal recognition particle r 94.69
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 94.57
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.55
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.51
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 94.49
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 94.39
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.38
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 94.37
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.34
d2qy9a2211 GTPase domain of the signal recognition particle r 94.33
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.32
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 94.24
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 94.23
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 94.17
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.13
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 94.03
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 94.02
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 93.95
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.93
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.83
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 93.82
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.68
d1vmaa2213 GTPase domain of the signal recognition particle r 93.61
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 93.5
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 93.41
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.39
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 93.25
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.11
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 93.01
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 92.96
d1tuea_205 Replication protein E1 helicase domain {Human papi 92.87
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 92.81
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 92.76
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.68
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.65
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 92.6
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.53
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 92.27
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 92.25
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 92.24
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 92.21
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 92.2
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 92.19
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.17
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 92.14
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 92.12
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 92.04
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 92.03
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 91.97
d2hyda1255 Putative multidrug export ATP-binding/permease pro 91.82
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 91.8
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 91.71
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 91.68
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 91.41
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 91.4
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.33
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 91.18
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.08
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 91.04
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 90.54
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 90.51
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 90.27
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.24
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 90.17
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 89.82
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 89.79
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 89.78
d1tuea_205 Replication protein E1 helicase domain {Human papi 89.6
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.47
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.43
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 89.27
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 89.15
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.11
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.07
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 89.06
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 89.06
d2fh5b1207 Signal recognition particle receptor beta-subunit 88.91
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 88.91
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 88.71
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.37
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 88.37
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 88.14
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 88.12
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 88.1
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 87.92
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 87.77
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 87.48
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 87.27
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 87.27
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 87.13
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 86.98
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 86.94
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 86.87
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 86.78
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 86.67
d1nrjb_209 Signal recognition particle receptor beta-subunit 86.53
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 86.41
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 86.3
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 86.28
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 86.17
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.16
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 86.14
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 86.1
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 85.78
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 85.77
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 85.66
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 85.58
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 85.55
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 85.53
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 85.5
d2fh5b1207 Signal recognition particle receptor beta-subunit 85.5
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 85.47
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 85.45
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 85.38
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 85.06
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 84.75
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 84.73
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 84.64
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 84.61
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 84.6
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 84.56
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 84.48
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 84.4
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 84.39
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 84.31
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 84.26
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 84.26
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 84.2
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 84.12
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 84.04
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 83.97
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 83.93
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 83.77
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 83.75
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 83.73
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 83.72
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 83.66
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 83.48
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 83.4
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 83.4
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 83.31
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 83.31
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 83.27
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 83.21
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 82.59
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 82.54
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 82.45
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 82.39
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 82.31
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 81.88
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 81.87
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 81.81
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 81.72
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 81.63
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 81.62
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 81.49
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 81.42
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 81.4
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 81.12
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 81.06
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 81.05
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 80.91
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 80.82
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 80.81
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 80.7
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 80.69
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 80.66
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 80.57
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 80.4
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 80.34
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 80.15
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=2.3e-38  Score=350.23  Aligned_cols=257  Identities=44%  Similarity=0.735  Sum_probs=226.6

Q ss_pred             ccccccCChhHHHHHhhhhhcccccccccccccccCCCcceeeecCCCChhHHHHHHHHhhhhhcCCeEEEEEecchhhH
Q 000973          376 VSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVL  455 (1205)
Q Consensus       376 ~~~~~i~Gl~~~k~~L~e~v~~pl~~~~~~~~~g~~~~~~vLL~GppGtGKT~laralA~~l~~~~~~~~~~~i~~~~l~  455 (1205)
                      |+|+||+|++.+|+.|++.|.+|+.+|+.|..+|+.+++|+|||||||||||++|+++|++++     .+|+.++++.+.
T Consensus         1 ~~~~dv~G~~~~k~~l~~~i~~~l~~~~~~~~~g~~~~~giLL~GppGtGKT~l~~ala~~~~-----~~~~~i~~~~l~   75 (258)
T d1e32a2           1 VGYDDVGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG-----AFFFLINGPEIM   75 (258)
T ss_dssp             CCGGGCCSCSHHHHHHHHHHHHHHHCHHHHHHCCCCCCCEEEEECCTTSSHHHHHHHHHHHTT-----CEEEEECHHHHT
T ss_pred             CChhhhccHHHHHHHHHHHHHHHhcCHHHHHhCCCCCCceeEEecCCCCCchHHHHHHHHHhC-----CeEEEEEchhhc
Confidence            689999999999999999999999999999999999999999999999999999999999985     789999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHhhcCCceEEEeccCCcccccchhhhHHHHHHHHHHHHHhhCcccCCcEEEEccccccccccc
Q 000973          456 SKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDG  535 (1205)
Q Consensus       456 ~~~~g~~e~~l~~lf~~a~~~~p~VL~IDEid~L~~~r~~~~~~~~~~v~~~Ll~~ld~~~~~~~viVI~atn~~~~ld~  535 (1205)
                      +.++|+....++.+|..|...+||||||||+|.|++++..........++..++..++......+++||+|||.++.||+
T Consensus        76 ~~~~g~~~~~l~~~f~~A~~~~p~il~iDeid~l~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~vlvi~tTn~~~~ld~  155 (258)
T d1e32a2          76 SKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDP  155 (258)
T ss_dssp             TSCTTHHHHHHHHHHHHHHHTCSEEEEESSGGGTCCHHHHCCCTTHHHHHHHHHHHHHTCCCSSCEEEEEEESCGGGSCG
T ss_pred             ccccccHHHHHHHHHHHHHhcCCeEEEehhhhhhccCCCCCCCchHHHHHHHhccccccccccCCccEEEeCCCccccch
Confidence            99999999999999999999999999999999999887666555667788999999998888899999999999999999


Q ss_pred             cccCCCCccccccCCCCCchhhhhhhhccccccCCCCchhHHHHHhhhhhcccchhHHHHhHHHHHHHHHHhCCceeccC
Q 000973          536 ALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSD  615 (1205)
Q Consensus       536 aL~r~gRf~~~I~~~~P~~eer~~Il~~~l~~~~~~~~~~~l~~LA~~t~G~sgadI~~L~~eA~~~a~rr~~~~i~~~~  615 (1205)
                      +++|+|||+..|+|++|+.++|..||+.++.+.....+.+ +..||..|.||+++||.++|++|++.++++....+...+
T Consensus       156 al~r~gRfd~~i~~~~P~~~~R~~il~~~l~~~~~~~~~~-~~~la~~t~G~s~adl~~lv~~A~~~a~~~~~~~~~~~~  234 (258)
T d1e32a2         156 ALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVD-LEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLED  234 (258)
T ss_dssp             GGTSTTSSCEEEECCCCCHHHHHHHHHHTTTTSCBCTTCC-HHHHHHHCTTCCHHHHHHHHHHHHHHHHHHHHHHHCCCS
T ss_pred             hhhhcccccceeECCCCCHHHHHHHhhhhccCcccccccc-hhhhhhcccCCCHHHHHHHHHHHHHHHHHhhccccchhh
Confidence            9999999999999999999999999999998876654444 589999999999999999999999999988654333222


Q ss_pred             CceEE-eccceeeeehhhhhhhcc
Q 000973          616 DKFLI-DVDSVTVEKYHFIEAMST  638 (1205)
Q Consensus       616 ~~~~~-d~~~~~It~~df~~al~~  638 (1205)
                      ..... ......|+.+||..||.+
T Consensus       235 ~~~~~~~~~~~~it~~Df~~AL~~  258 (258)
T d1e32a2         235 ETIDAEVMNSLAVTMDDFRWALSQ  258 (258)
T ss_dssp             SCCBHHHHHHCCBCHHHHHHHHTC
T ss_pred             hhhhhhhhccCccCHHHHHHHhCc
Confidence            11100 112345888999988863
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure