Citrus Sinensis ID: 001003

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190--

MSFAAYKMMHWPTGIANCGSGFITHSRADYVPQIPLIQTEELDSELPSKRGIGPVPNLVVTAANVIEIYVVRVQEEGSKESKNSGETKRRVLMDGISAASLELVCHYRLHGNVESLAILSQGGADNSRRRDSIILAFEDAKISVLEFDDSIHGLRITSMHCFESPEWLHLKRGRESFARGPLVKVDPQGRCGGVLVYGLQMIILKASQGGSGLVGDEDTFGSGGGFSARIESSHVINLRDLDMKHVKDFIFVHGYIEPVMVILHERELTWAGRVSWKHHTCMISALSISTTLKQHPLIWSAMNLPHDAYKLLAVPSPIGGVLVVGANTIHYHSQSASCALALNNYAVSLDSSQELPRSSFSVELDAAHATWLQNDVALLSTKTGDLVLLTVVYDGRVVQRLDLSKTNPSVLTSDITTIGNSLFFLGSRLGDSLLVQFTCGSGTSMLSSGLKEEFGDIEADAPSTKRLRRSSSDALQDMVNGEELSLYGSASNNTESAQKTFSFAVRDSLVNIGPLKDFSYGLRINADASATGISKQSNYELVELPGCKGIWTVYHKSSRGHNADSSRMAAYDDEYHAYLIISLEARTMVLETADLLTEVTESVDYFVQGRTIAAGNLFGRRRVIQVFERGARILDGSYMTQDLSFGPSNSESGSGSENSTVLSVSIADPYVLLGMSDGSIRLLVGDPSTCTVSVQTPAAIESSKKPVSSCTLYHDKGPEPWLRKTSTDAWLSTGVGEAIDGADGGPLDQGDIYSVVCYESGALEIFDVPNFNCVFTVDKFVSGRTHIVDTYMREALKDSETEINSSSEEGTGQGRKENIHSMKVVELAMQRWSAHHSRPFLFAILTDGTILCYQAYLFEGPENTSKSDDPVSTSRSLSVSNVSASRLRNLRFSRTPLDAYTREETPHGAPCQRITIFKNISGHQGFFLSGSRPCWCMVFRERLRVHPQLCDGSIVAFTVLHNVNCNHGFIYVTSQGILKICQLPSGSTYDNYWPVQKVIPLKATPHQITYFAEKNLYPLIVSVPVLKPLNQVLSLLIDQEVGHQIDNHNLSSVDLHRTYTVEEYEVRILEPDRAGGPWQTRATIPMQSSENALTVRVVTLFNTTTKENETLLAIGTAYVQGEDVAARGRVLLFSTGRNADNPQNLVLSGSYGPLFSSVQIDFASHFFAICSNSFVFVFLFSFLRSLFIIGNV

cccEEEEEcccccCEEEEEEEEECcccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEEEcccccccccccccccccEEccccccccEEEEEEEEEEEEEEEEEEEEcccccccccccEEEEEEccccEEEEEECcccccEEEEEEEECcccccccccccccccccccEEEEcccccEEEEEEEccEEEEEEccccccccccccccccccccccccccccEEEEcccccccEEEEEEEEccccccEEEEEEEcccccccccEEcccEEEEEEEEEccccccccEEEEcccccccccCEEECcccccEEEEEEccEEEEEccccccEEEccccccccccccccccCEEEEEEEEEEEEEEEccEEEEEEccccEEEEEEEEcccEEEEEEEEECccccccccEEEEcccEEEEEEEEccEEEEEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccccEEEccccccccccccccccccccEEEEcccccCEEEEEEccccccccccccccccccccccEEEEEEEccEEEEEEcccEEEEEEccccccccccEEEEEEccccEEEEEEcccEEEEEcccccCEECccccccccccccccccEEEEEEcccEEEEEECccEEEEEEEcccccEEEEEcccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEECccccEEEEEEcccccccCEEEEccccccccccccccccccccccccccccccccccEEEEEEccccccccccEEEEEEEcccEEEEEEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccEEEEEcccccEEEEEEcccCEEECccccccEEEEEEEEcccccccEEEEEccccEEEEEccccccccccccEEEEEcccccccEEEEcccccEEEEEEECcccccccccccccccccccccccccccccccccccccccEEEEEEECccccccccEEEEEEEccccccEEEEEEEEEEcccccccccEEEEEEccccccccccccEEEEEEEEEEccccccccccccEEcccccccccccccEEEEEEccEEEEEEEEcccEEEEEccc

**FAAYKMMHWPTGIANCGSGFITHSRADYVPQIPLIQTEEL*******RGIGPVPNLVVTAANVIEIYVVRV*********************GISAASLELVCHYRLHGNVESLAILSQGGA**SRRRDSIILAFEDAKISVLEFDDSIHGLRITSMHCFESPEWLHLKRGRESFARGPLVKVDPQGRCGGVLVYGLQMIILKASQGGSGLVGDEDTF**GGGFSARIESSHVINLRDLDMKHVKDFIFVHGYIEPVMVILHERELTWAGRVSWKHHTCMISALSISTTLKQHPLIWSAMNLPHDAYKLLAVPSPIGGVLVVGANTIHYHSQSASCALALNNYAVSLDSSQELPRSSFSVELDAAHATWLQNDVALLSTKTGDLVLLTVVYDGRVVQRLDLSKTNPSVLTSDITTIGNSLFFLGSRLGDSLLVQFTCGSGT**********************RLRRSSSDALQDMVNGEELS**************TFSFAVRDSLVNIGPLKDFSYGLRINADASATGISKQSNYELVELPGCKGIWTVYHK**************YDDEYHAYLIISLEARTMVLETADLLTEVTESVDYFVQGRTIAAGNLFGRRRVIQVFERGARILDGSYMTQDLSFGPSNSESGSGSENSTVLSVSIADPYVLLGMSDGSIRLLVGDPSTCTVSVQT***IESSKKPVSSCTLYHDKGPEPWLRKTSTDAWLSTGVGEAIDGADGGPLDQGDIYSVVCYESGALEIFDVPNFNCVFTVDKFVSGRTHIVDTYMR****************************MKVVELAMQRWSAHHSRPFLFAILTDGTILCYQAYLFE************************************************GAPCQRITIFKNISGHQGFFLSGSRPCWCMVFRERLRVHPQLCDGSIVAFTVLHNVNCNHGFIYVTSQGILKICQLPSGSTYDNYWPVQKVIPLKATPHQITYFAEKNLYPLIVSVPVLKPLNQVLSLLIDQEVGHQIDNHNLSSVDLHRTYTVEEYEVRILEPDRAGGPWQTRATIPMQSSENALTVRVVTLFNTTTKENETLLAIGTAYVQGEDVAARGRVLLFSTGRNADNPQNLVLSGSYGPLFSSVQIDFASHFFAICSNSFVFVFLFSFLRSLFIIGNV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cleavage and polyadenylation specificity factor subunit 1	CPSF plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A)polymerase and other factors to bring about cleavage and poly(A) addition. This subunit is involved in the RNA recognition step of the polyadenylation reaction.	probable	Q9FGR0
Probable cleavage and polyadenylation specificity factor subunit 1	CPSF plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A)polymerase and other factors to bring about cleavage and poly(A) addition. This subunit is involved in the RNA recognition step of the polyadenylation reaction.	probable	Q7XWP1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EI3, chain A
Confidence level:very confident
Coverage over the Query: 1-29,57-77,101-212,231-342,353-441,452,477,499-556,571-716,745-789,821-867,883-892,909-1183
View the alignment between query and template
View the model in PyMOL

Template: 4A08, chain A
Confidence level:probable
Coverage over the Query: 185-213,224-239,251-341,353-475,500-529,542-559,574-634
View the alignment between query and template
View the model in PyMOL