Citrus Sinensis ID: 001041

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------118
MNGESNSNEASASKSQEEVGKDSSMSGNEHDSEKGKQTEKTESVPFYKLFTFADSADTALMIIGSIGAIGNGLCLPLMTLLFGDLINTFGDNQNNSETVDKVSKVAVKFVYLGIGSGIASFLQVTCWMITGERQATRIRGLYLKTILRQDVAFFDNETNTGEVVGRMSGDTVLIQDAMGEKVGKFLQLMATFLGGFLIAFIKGWLLTLVMLSSIPLLAMSGGVMAIMISKMSSRGQGAYAKAASVVEQTIGSIRTVASFTGEKQAMSNYKKFLVTAYKSGVQEGLAAGIGLGMVMLIVFCSYALSVWYGGKLILEEGYNGGQVVNVMVAVLTGSMSLGEASPCLSAFGAGQAAAFKMFETINRKPEIDAYDTKGKILDDIRGDIELRDVYFSYPARPNEQIFSGFSISISSGTTAALVGQSGSGKSTVISLIERFYDPQAGEVLIDGINLKEFQLQWIRKKIGLVSQEPVLFTGSIKDNIAYGKDDATTEEIRVATELANAAKFIDKLPQGIDTLVGEHGTQLSGGQKQRIAIARAILKDPRILLLDEATSALDAESEKVVQEALDRIMVNRTTVIVAHRLSTVRNADMIAVIHRGKIVEKGTHSKLVEDPEGAYSQLIRLQEANKESEQTIDGQRKSEISMESLRHSSHRMSLRRSISRGSSIGNSSRHSISVSFGLPSGQFADTALGEPAGPSQPTEEVAPEVPTRRLAYLNKPEIPVILAGTIAAMANGVILPIYGLLISSVIETFFKPPHELKKDSRFWALIYLALGAGSFLLSPAQSYFFAVAGNKLIQRIRSMCFEKVIHMEVSWFDEPEHSSGAIGARLSADAASVRALVGDALARIVQNISTAAAGLIIAFTASWQLALIILVMLPLIGVSGYTQMKFMKGFSADAKMKYEEASQVANDAVGSIRTVASFCAEEKVMQLYKKKCEAPMKTGIRQGMVSGGGFGASFFLLFAFYAASFYAGARLVEDGKATFSDVFKVFFSLTMTAIGISQSSSFSSDSNKAKSAAASIFAIIDRESKIDPSDESGTILEDVKGEIELHHVSFKYPSRPDVQVFRDLNLKIRAGKTVALVGESGSGKSTVVSLLQRFYDPDAGHITLDGVEIQKLQLKWLRQQMGLVSQEPVLFNDTIRANIAYGKGGDATEAEIQAASEMANAHKFICSLQQVRTSRLLL
cccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccccccccccccccCEEEEEEEEECcccccccccccccEEEEEcccEEEEEccccccHHHHHHHHHHcccccccEEEEcccccccccHHHHHccccccccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccEEEcccccccccHHHHHHHHHHHHHHHccccEEEEEccccccccccEEEEEEccEEEEEccHHHHHccccccHHHHHHHHHHcccHHHccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccccccccccCEEEEEEEEECccccccccccccccEEEEcccEEEEEccccccHHHHHHHHHccccccccEEEEcccccccccHHHHHHHccccccccccccccHHHHHHccccccccHHHHHHHHHHHcHHHHHHHccccccccccc
*******************************************VPFYKLFTFADSADTALMIIGSIGAIGNGLCLPLMTLLFGDLINTFGDNQNNSETVDKVSKVAVKFVYLGIGSGIASFLQVTCWMITGERQATRIRGLYLKTILRQDVAFFDNETNTGEVVGRMSGDTVLIQDAMGEKVGKFLQLMATFLGGFLIAFIKGWLLTLVMLSSIPLLAMSGGVMAIMISKM********AKAASVVEQTIGSIRTVASFTGEKQAMSNYKKFLVTAYKSGVQEGLAAGIGLGMVMLIVFCSYALSVWYGGKLILEEGYNGGQVVNVMVAVLTGSMSLGEASPCLSAFGAGQAAAFKMFETINRKPEIDAYDTKGKILDDIRGDIELRDVYFSYPARPNEQIFSGFSISISSGTTAALVGQSGSGKSTVISLIERFYDPQAGEVLIDGINLKEFQLQWIRKKIGLVSQEPVLFTGSIKDNIAYGKDDATTEEIRVATELANAAKFIDKLPQGIDTLVGEHGTQLSGGQKQRIAIARAILKDPRILLLDEATSALDAESEKVVQEALDRIMVNRTTVIVAHRLSTVRNADMIAVIHRGKIVEKGTHSKLVEDPEGAYSQLIR************************************************************************************VPTRRLAYLNKPEIPVILAGTIAAMANGVILPIYGLLISSVIETFFKPPHELKKDSRFWALIYLALGAGSFLLSPAQSYFFAVAGNKLIQRIRSMCFEKVIHMEVSWFDEPEHSSGAIGARLSADAASVRALVGDALARIVQNISTAAAGLIIAFTASWQLALIILVMLPLIGVSGYTQMKFMKGFSADAKMKYEEASQVANDAVGSIRTVASFCAEEKVMQLYKKKCEAPMKTGIRQGMVSGGGFGASFFLLFAFYAASFYAGARLVEDGKATFSDVFKVFFSLTMTAIGISQSSSFSSDSNKAKSAAASIFAIID*************ILEDVKGEIELHHVSFKYPSRPDVQVFRDLNLKIRAGKTVALVGESGSGKSTVVSLLQRFYDPDAGHITLDGVEIQKLQLKWLRQQMGLVSQEPVLFNDTIRANIAYGKGGDATEAEIQAASEMANAHKFICSLQQVRTSRLLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNGESNSNEASASKSQEEVGKDSSMSGNEHDSEKGKQTEKTESVPFYKLFTFADSADTALMIIGSIGAIGNGLCLPLMTLLFGDLINTFGDNQNNSETVDKVSKVAVKFVYLGIGSGIASFLQVTCWMITGERQATRIRGLYLKTILRQDVAFFDNETNTGEVVGRMSGDTVLIQDAMGEKVGKFLQLMATFLGGFLIAFIKGWLLTLVMLSSIPLLAMSGGVMAIMISKMSSRGQGAYAKAASVVEQTIGSIRTVASFTGEKQAMSNYKKFLVTAYKSGVQEGLAAGIGLGMVMLIVFCSYALSVWYGGKLILEEGYNGGQVVNVMVAVLTGSMSLGEASPCLSAFGAGQAAAFKMFETINRKPEIDAYDTKGKILDDIRGDIELRDVYFSYPARPNEQIFSGFSISISSGTTAALVGQSGSGKSTVISLIERFYDPQAGEVLIDGINLKEFQLQWIRKKIGLVSQEPVLFTGSIKDNIAYGKDDATTEEIRVATELANAAKFIDKLPQGIDTLVGEHGTQLSGGQKQRIAIARAILKDPRILLLDEATSALDAESEKVVQEALDRIMVNRTTVIVAHRLSTVRNADMIAVIHRGKIVEKGTHSKLVEDPEGAYSQLIRLQEANKESEQTIDGQRKSEISMESLRHSSHRMSLRRSISRGSSIGNSSRHSISVSFGLPSGQFADTALGEPAGPSQPTEEVAPEVPTRRLAYLNKPEIPVILAGTIAAMANGVILPIYGLLISSVIETFFKPPHELKKDSRFWALIYLALGAGSFLLSPAQSYFFAVAGNKLIQRIRSMCFEKVIHMEVSWFDEPEHSSGAIGARLSADAASVRALVGDALARIVQNISTAAAGLIIAFTASWQLALIILVMLPLIGVSGYTQMKFMKGFSADAKMKYEEASQVANDAVGSIRTVASFCAEEKVMQLYKKKCEAPMKTGIRQGMVSGGGFGASFFLLFAFYAASFYAGARLVEDGKATFSDVFKVFFSLTMTAIGISQSSSFSSDSNKAKSAAASIFAIIDRESKIDPSDESGTILEDVKGEIELHHVSFKYPSRPDVQVFRDLNLKIRAGKTVALVGESGSGKSTVVSLLQRFYDPDAGHITLDGVEIQKLQLKWLRQQMGLVSQEPVLFNDTIRANIAYGKGGDATEAEIQAASEMANAHKFICSLQQVRTSRLLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ABC transporter B family member 11 confidentQ9FWX7
ABC transporter B family member 21 probableQ9M1Q9
ABC transporter B family member 4 Auxin influx transporter that mediates the transport of auxin in roots. Contributes to the basipetal transport in hypocotyls and root tips by establishing an auxin uptake sink in the root cap. Confers sensitivity to 1-N-naphthylphthalamic acid (NPA). Regulates the root elongation, the initiation of lateral roots and the development of root hairs. Can transports IAA, indole-3-propionic acid, NPA syringic acid, vanillic acid and some auxin metabolites, but not 2,4-D and 1-naphthaleneacetic acid.probableO80725

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NH6, chain A
Confidence level:very confident
Coverage over the Query: 348-624
View the alignment between query and template
View the model in PyMOL
Template: 3QF4, chain B
Confidence level:very confident
Coverage over the Query: 44-623
View the alignment between query and template
View the model in PyMOL
Template: 3QF4, chain B
Confidence level:very confident
Coverage over the Query: 705-1177
View the alignment between query and template
View the model in PyMOL
Template: 3G5U, chain A
Confidence level:very confident
Coverage over the Query: 44-628
View the alignment between query and template
View the model in PyMOL