Citrus Sinensis ID: 001054
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1171 | 2.2.26 [Sep-21-2011] | |||||||
| Q9FJR0 | 1254 | Regulator of nonsense tra | yes | no | 0.761 | 0.711 | 0.842 | 0.0 | |
| Q92900 | 1129 | Regulator of nonsense tra | yes | no | 0.645 | 0.669 | 0.589 | 0.0 | |
| Q9EPU0 | 1124 | Regulator of nonsense tra | yes | no | 0.642 | 0.669 | 0.589 | 0.0 | |
| Q98TR3 | 1097 | Putative regulator of non | N/A | no | 0.575 | 0.614 | 0.618 | 0.0 | |
| Q9HEH1 | 1093 | Regulator of nonsense tra | N/A | no | 0.514 | 0.551 | 0.661 | 0.0 | |
| Q9VYS3 | 1180 | Regulator of nonsense tra | yes | no | 0.511 | 0.507 | 0.646 | 0.0 | |
| Q09820 | 925 | ATP-dependent helicase up | yes | no | 0.513 | 0.649 | 0.597 | 0.0 | |
| P30771 | 971 | ATP-dependent helicase NA | yes | no | 0.507 | 0.611 | 0.590 | 0.0 | |
| O76512 | 1069 | Regulator of nonsense tra | yes | no | 0.500 | 0.548 | 0.575 | 0.0 | |
| Q54I89 | 1331 | Regulator of nonsense tra | yes | no | 0.517 | 0.455 | 0.571 | 0.0 |
| >sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 1565 bits (4052), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 770/914 (84%), Positives = 827/914 (90%), Gaps = 22/914 (2%)
Query: 240 MMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSV 299
MMKESQSK+N+T+RWDIGLNKKRVAYFVFPKE+NELRLVPGDELRLRYSGDA HP+WQSV
Sbjct: 338 MMKESQSKENLTVRWDIGLNKKRVAYFVFPKEENELRLVPGDELRLRYSGDAVHPSWQSV 397
Query: 300 GHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSG 359
GHVIKLTAQEEVALELRA+QGVP+D+NHGFSVDFVWKSTSFDRMQGAMK FAVDETSVSG
Sbjct: 398 GHVIKLTAQEEVALELRANQGVPIDVNHGFSVDFVWKSTSFDRMQGAMKNFAVDETSVSG 457
Query: 360 YIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKT 419
YIYH LLGHEVE QMVRNTLPRRFG PGLPELNASQV AVKSVLQ+PISLIQGPPGTGKT
Sbjct: 458 YIYHQLLGHEVEAQMVRNTLPRRFGVPGLPELNASQVNAVKSVLQKPISLIQGPPGTGKT 517
Query: 420 VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHL 479
VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVE+L
Sbjct: 518 VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEYL 577
Query: 480 TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTC 539
TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYK LKRATEREI+QSADVICCTC
Sbjct: 578 TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKNLKRATEREITQSADVICCTC 637
Query: 540 VGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAAR 599
VGA D RL+NFRFRQVLIDESTQATEPECLIPLVLG KQVVLVGDHCQLGPVIMCKKAAR
Sbjct: 638 VGAADLRLSNFRFRQVLIDESTQATEPECLIPLVLGVKQVVLVGDHCQLGPVIMCKKAAR 697
Query: 600 AGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDF 659
AGLAQSLFERLV LG+KPIRLQVQYRMHP+LSEFPSNSFYEGTLQNGVTI ERQ++GIDF
Sbjct: 698 AGLAQSLFERLVTLGIKPIRLQVQYRMHPALSEFPSNSFYEGTLQNGVTIIERQTTGIDF 757
Query: 660 PWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYE 719
PWPVPNRPMFFYVQ+GQEEISASGTSYLNRTEAANVEK+VT FL+SGVVPSQIGVITPYE
Sbjct: 758 PWPVPNRPMFFYVQLGQEEISASGTSYLNRTEAANVEKLVTAFLKSGVVPSQIGVITPYE 817
Query: 720 GQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 779
GQRAYIVNYM+RNG+LRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR
Sbjct: 818 GQRAYIVNYMARNGSLRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 877
Query: 780 RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPK 839
RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKP+
Sbjct: 878 RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPR 937
Query: 840 KIYNDRRLFFGAGPGIVPND-ISTSNPNAD---RRGSRARGYMPPGPPNGTHKPGLHPAG 895
KIYNDRRLF+G G G++ ND + NPNAD RG Y+P GPPNG +PGLHPAG
Sbjct: 938 KIYNDRRLFYGGGAGMIGNDNFGSGNPNADRRGSRGRAGGSYLPSGPPNGA-RPGLHPAG 996
Query: 896 FPMPRVPLPPFQGGPPSQPYAIPSRGAVHGPVGAVHHVPPPGSRGFGAGRGSAGAPIGSH 955
+P+PRVPL PF GGPPSQPYAIP+R GPVGAV H P PG+ GFGAGRG++ +G H
Sbjct: 997 YPIPRVPLSPFPGGPPSQPYAIPTR----GPVGAVPHAPQPGNHGFGAGRGTS---VGGH 1049
Query: 956 LQHQQNTQQPIGTIGSTFNFPSLENSNSQPSVGGPLTQPGFVNNMPVQGPSQTFRDGFSV 1015
L HQQ TQ +GTIG + NFP L++ NSQPS GGPL+QPG+ SQ FRDGFS+
Sbjct: 1050 LPHQQATQHNVGTIGPSLNFP-LDSPNSQPSPGGPLSQPGY--------GSQAFRDGFSM 1100
Query: 1016 GSMSQDFLGDDFKSQGSHVPYNVAEFSTQASQSGYAVDYVTQGAQGGFPGNFLNQNSQAG 1075
G +SQDFL DD KSQGSH PYN+A+F+TQAS G+AVDY TQGA G FPGNF+NQNSQ G
Sbjct: 1101 GGISQDFLADDIKSQGSHDPYNMADFATQASPGGFAVDYATQGAHGAFPGNFMNQNSQGG 1160
Query: 1076 YSRFGSGNDFMSQDYMAHGSQGLFTQAGYNEPTQDDASQSHFGVVNPNALQTQGMMNSLY 1135
YSRF NDFMSQ+YMAHG QGLFTQAG+ + +QDD Q+ +GV NPN LQ+QG+ NSLY
Sbjct: 1161 YSRFSGINDFMSQEYMAHGGQGLFTQAGFIDSSQDDGQQNPYGVNNPN-LQSQGLPNSLY 1219
Query: 1136 SQPFAHYNSQPLNL 1149
SQPFAHYN+QPLNL
Sbjct: 1220 SQPFAHYNTQPLNL 1233
|
Eliminates the production of nonsense-containing RNAs. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: - |
| >sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q98TR3|RENT1_TAKRU Putative regulator of nonsense transcripts 1 OS=Takifugu rubripes GN=rent1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9VYS3|RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster GN=Upf1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q09820|RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf1 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O76512|RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans GN=smg-2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q54I89|RENT1_DICDI Regulator of nonsense transcripts 1 OS=Dictyostelium discoideum GN=upf1 PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1171 | ||||||
| 359474491 | 1267 | PREDICTED: regulator of nonsense transcr | 0.795 | 0.735 | 0.924 | 0.0 | |
| 255575790 | 1280 | nonsense-mediated mRNA decay protein, pu | 0.795 | 0.727 | 0.931 | 0.0 | |
| 224138824 | 1256 | predicted protein [Populus trichocarpa] | 0.784 | 0.731 | 0.909 | 0.0 | |
| 356497066 | 1266 | PREDICTED: regulator of nonsense transcr | 0.788 | 0.729 | 0.898 | 0.0 | |
| 357482277 | 1253 | Regulator of nonsense transcripts-like p | 0.789 | 0.738 | 0.903 | 0.0 | |
| 356541331 | 1270 | PREDICTED: regulator of nonsense transcr | 0.769 | 0.709 | 0.902 | 0.0 | |
| 449511522 | 1268 | PREDICTED: regulator of nonsense transcr | 0.776 | 0.716 | 0.902 | 0.0 | |
| 224126379 | 1242 | predicted protein [Populus trichocarpa] | 0.770 | 0.726 | 0.894 | 0.0 | |
| 449464902 | 1246 | PREDICTED: LOW QUALITY PROTEIN: regulato | 0.757 | 0.711 | 0.873 | 0.0 | |
| 218199657 | 1277 | hypothetical protein OsI_26082 [Oryza sa | 0.769 | 0.705 | 0.846 | 0.0 |
| >gi|359474491|ref|XP_002279304.2| PREDICTED: regulator of nonsense transcripts 1 homolog [Vitis vinifera] gi|297742168|emb|CBI33955.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1790 bits (4637), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 874/945 (92%), Positives = 903/945 (95%), Gaps = 13/945 (1%)
Query: 240 MMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSV 299
MMKESQSKDNVTIRWDIGLNKKR+AYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSV
Sbjct: 323 MMKESQSKDNVTIRWDIGLNKKRIAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSV 382
Query: 300 GHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSG 359
GHVIKLTAQEEVALELRASQGVPVD+NHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSG
Sbjct: 383 GHVIKLTAQEEVALELRASQGVPVDVNHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSG 442
Query: 360 YIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKT 419
YIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQ+PISLIQGPPGTGKT
Sbjct: 443 YIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQKPISLIQGPPGTGKT 502
Query: 420 VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHL 479
VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHL
Sbjct: 503 VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHL 562
Query: 480 TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTC 539
TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTC
Sbjct: 563 TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTC 622
Query: 540 VGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAAR 599
VGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLG KQVVLVGDHCQLGPVIMCKKAAR
Sbjct: 623 VGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGVKQVVLVGDHCQLGPVIMCKKAAR 682
Query: 600 AGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDF 659
AGLAQSLFERLVLLG+KPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDF
Sbjct: 683 AGLAQSLFERLVLLGVKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDF 742
Query: 660 PWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYE 719
PWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYE
Sbjct: 743 PWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYE 802
Query: 720 GQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 779
GQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR
Sbjct: 803 GQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 862
Query: 780 RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPK 839
RLNVALTRARYGIVILGNPKVLSKQPLWN LLTHYKEHECLVEGPLNNLKQSMVQFQKPK
Sbjct: 863 RLNVALTRARYGIVILGNPKVLSKQPLWNSLLTHYKEHECLVEGPLNNLKQSMVQFQKPK 922
Query: 840 KIYNDRRLFFGAGPGIVPND----ISTSNPNADRRGSRARG-YMPPGPPNGTHKPGLHPA 894
KIYNDRRLFFG GPGIVPND +++S+P+ADRR SR RG YMP GPPNGTHKPG+HPA
Sbjct: 923 KIYNDRRLFFGGGPGIVPNDNFGTVTSSSPSADRRSSRGRGSYMPSGPPNGTHKPGVHPA 982
Query: 895 GFPMPRVPLPPFQGGPPSQPYAIPSRGAVHGPVGAVHHVPPPGSRGFGAGRGSAGAPIGS 954
GFPMPRVPLPPF GGPPSQPYAIP+RGAVHGPVGAV HVPPPGSRGFGAGRG+AGAPIGS
Sbjct: 983 GFPMPRVPLPPFHGGPPSQPYAIPTRGAVHGPVGAVPHVPPPGSRGFGAGRGNAGAPIGS 1042
Query: 955 HLQHQQNTQQPIGTIGSTFNFPSLENSNSQPSVGGPLTQPGFVNNMPVQGPSQTFRDGFS 1014
HL HQQ +QQ +G +GSTFNFP+LEN NSQPSVGGPL+QPGFV NMPVQGPSQTFRDGFS
Sbjct: 1043 HLPHQQGSQQAVGNLGSTFNFPALENPNSQPSVGGPLSQPGFVTNMPVQGPSQTFRDGFS 1102
Query: 1015 VGSMSQDFLGDDFKSQGSHVPYNVAEFSTQASQSGYAVDYVTQGAQGGFPGNFLNQNSQA 1074
+G MSQDFLGDDFKSQGSHVPYNVA+FSTQASQSGY +DY TQGAQ GFPG+FLNQNSQA
Sbjct: 1103 IGGMSQDFLGDDFKSQGSHVPYNVADFSTQASQSGYTLDYATQGAQAGFPGSFLNQNSQA 1162
Query: 1075 GYSRFGSGNDFMSQDYMAHGSQGLFTQAGYNEPTQDDASQSHFGVVNPNALQTQGMMNSL 1134
GY+RFG+GNDFMSQDYMAHGSQGLFTQ G+N+P+QDDASQSHFGV NPN LQ+QG+MN L
Sbjct: 1163 GYTRFGTGNDFMSQDYMAHGSQGLFTQVGFNDPSQDDASQSHFGVANPNPLQSQGLMNPL 1222
Query: 1135 YSQPFAHYNSQPLNL--------QSPQQQPQPGQGSQNQKNHYNG 1171
YSQPFAHYN+QPLNL Q Q PQ GQ SQNQK HYNG
Sbjct: 1223 YSQPFAHYNTQPLNLQAPQQQQQQQQQTPPQQGQSSQNQKLHYNG 1267
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255575790|ref|XP_002528794.1| nonsense-mediated mRNA decay protein, putative [Ricinus communis] gi|223531797|gb|EEF33616.1| nonsense-mediated mRNA decay protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224138824|ref|XP_002326699.1| predicted protein [Populus trichocarpa] gi|222834021|gb|EEE72498.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356497066|ref|XP_003517385.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357482277|ref|XP_003611424.1| Regulator of nonsense transcripts-like protein [Medicago truncatula] gi|355512759|gb|AES94382.1| Regulator of nonsense transcripts-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356541331|ref|XP_003539131.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449511522|ref|XP_004163978.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224126379|ref|XP_002329539.1| predicted protein [Populus trichocarpa] gi|222870248|gb|EEF07379.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449464902|ref|XP_004150168.1| PREDICTED: LOW QUALITY PROTEIN: regulator of nonsense transcripts 1 homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|218199657|gb|EEC82084.1| hypothetical protein OsI_26082 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1171 | ||||||
| TAIR|locus:2171007 | 1254 | LBA1 "LOW-LEVEL BETA-AMYLASE 1 | 0.755 | 0.705 | 0.829 | 0.0 | |
| UNIPROTKB|E1C0J4 | 1117 | UPF1 "Uncharacterized protein" | 0.573 | 0.601 | 0.657 | 9.8e-302 | |
| MGI|MGI:107995 | 1124 | Upf1 "UPF1 regulator of nonsen | 0.512 | 0.533 | 0.706 | 6.1e-300 | |
| ZFIN|ZDB-GENE-040426-2836 | 1100 | upf1 "upf1 regulator of nonsen | 0.567 | 0.603 | 0.661 | 2.1e-299 | |
| UNIPROTKB|E1C0J3 | 1128 | UPF1 "Uncharacterized protein" | 0.573 | 0.595 | 0.646 | 1.1e-298 | |
| UNIPROTKB|Q92900 | 1129 | UPF1 "Regulator of nonsense tr | 0.562 | 0.583 | 0.651 | 6.3e-298 | |
| UNIPROTKB|E1BEK9 | 1127 | UPF1 "Uncharacterized protein" | 0.562 | 0.584 | 0.653 | 6.3e-298 | |
| UNIPROTKB|E2RL81 | 1130 | UPF1 "Uncharacterized protein" | 0.562 | 0.583 | 0.653 | 6.3e-298 | |
| UNIPROTKB|G4ND47 | 1105 | MGG_00976 "Regulator-nonsense | 0.540 | 0.572 | 0.634 | 7.2e-267 | |
| FB|FBgn0030354 | 1180 | Upf1 "Upf1" [Drosophila melano | 0.561 | 0.556 | 0.607 | 1.8e-262 |
| TAIR|locus:2171007 LBA1 "LOW-LEVEL BETA-AMYLASE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3890 (1374.4 bits), Expect = 0., Sum P(2) = 0.
Identities = 752/907 (82%), Positives = 805/907 (88%)
Query: 240 MMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSV 299
MMKESQSK+N+T+RWDIGLNKKRVAYFVFPKE+NELRLVPGDELRLRYSGDA HP+WQSV
Sbjct: 338 MMKESQSKENLTVRWDIGLNKKRVAYFVFPKEENELRLVPGDELRLRYSGDAVHPSWQSV 397
Query: 300 GHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSG 359
GHVIKLTAQEEVALELRA+QGVP+D+NHGFSVDFVWKSTSFDRMQGAMK FAVDETSVSG
Sbjct: 398 GHVIKLTAQEEVALELRANQGVPIDVNHGFSVDFVWKSTSFDRMQGAMKNFAVDETSVSG 457
Query: 360 YIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKT 419
YIYH LLGHEVE QMVRNTLPRRFG PGLPELNASQV AVKSVLQ+PISLIQGPPGTGKT
Sbjct: 458 YIYHQLLGHEVEAQMVRNTLPRRFGVPGLPELNASQVNAVKSVLQKPISLIQGPPGTGKT 517
Query: 420 VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHL 479
VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVE+L
Sbjct: 518 VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEYL 577
Query: 480 TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTC 539
TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYK LKRATEREI+QSADVICCTC
Sbjct: 578 TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKNLKRATEREITQSADVICCTC 637
Query: 540 VGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAAR 599
VGA D RL+NFRFRQVLIDESTQATEPECLIPLVLG KQVVLVGDHCQLGPVIMCKKAAR
Sbjct: 638 VGAADLRLSNFRFRQVLIDESTQATEPECLIPLVLGVKQVVLVGDHCQLGPVIMCKKAAR 697
Query: 600 AGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDF 659
AGLAQSLFERLV LG+KPIRLQVQYRMHP+LSEFPSNSFYEGTLQNGVTI ERQ++GIDF
Sbjct: 698 AGLAQSLFERLVTLGIKPIRLQVQYRMHPALSEFPSNSFYEGTLQNGVTIIERQTTGIDF 757
Query: 660 PWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYE 719
PWPVPNRPMFFYVQ+GQEEISASGTSYLNRTEAANVEK+VT FL+SGVVPSQIGVITPYE
Sbjct: 758 PWPVPNRPMFFYVQLGQEEISASGTSYLNRTEAANVEKLVTAFLKSGVVPSQIGVITPYE 817
Query: 720 GQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 779
GQRAYIVNYM+RNG+LRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR
Sbjct: 818 GQRAYIVNYMARNGSLRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 877
Query: 780 RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPK 839
RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKP+
Sbjct: 878 RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPR 937
Query: 840 KIYNDRRLFFGAGPGIVPND-ISTSNPNADRRGSRARG---YMPPGPPNGTHKPGLHPAG 895
KIYNDRRLF+G G G++ ND + NPNADRRGSR R Y+P GPPNG +PGLHPAG
Sbjct: 938 KIYNDRRLFYGGGAGMIGNDNFGSGNPNADRRGSRGRAGGSYLPSGPPNGA-RPGLHPAG 996
Query: 896 FPMPRVPLPPFQGGPPSQPYAIPSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGSH 955
+P+PRVPL PF GGPPSQPYAIP+R +G H
Sbjct: 997 YPIPRVPLSPFPGGPPSQPYAIPTRGPVGAVPHAPQPGNHGFGAGRGTS-------VGGH 1049
Query: 956 LQHQQNTQQPIGTIGSTFNFPSLENSNSQPSVGGPLTQPGFVNNMPVQGPSQTFRDGFSV 1015
L HQQ TQ +GTIG + NFP L++ NSQPS GGPL+QPG+ G SQ FRDGFS+
Sbjct: 1050 LPHQQATQHNVGTIGPSLNFP-LDSPNSQPSPGGPLSQPGY-------G-SQAFRDGFSM 1100
Query: 1016 GSMSQDFLGDDFKSQGSHVPYNVAEFSTQASQSGYAVDYVTQGAQGGFPGNFLNQNSQAG 1075
G +SQDFL DD KSQGSH PYN+A+F+TQAS G+AVDY TQGA G FPGNF+NQNSQ G
Sbjct: 1101 GGISQDFLADDIKSQGSHDPYNMADFATQASPGGFAVDYATQGAHGAFPGNFMNQNSQGG 1160
Query: 1076 YSRFGSGNDFMSQDYMAHGSQGLFTQAGYNEPTQDDASQSHFGVVNPNALQTQGMMNSLY 1135
YSRF NDFMSQ+YMAHG QGLFTQAG+ + +QDD Q+ +GV NPN LQ+QG+ NSLY
Sbjct: 1161 YSRFSGINDFMSQEYMAHGGQGLFTQAGFIDSSQDDGQQNPYGVNNPN-LQSQGLPNSLY 1219
Query: 1136 SQPFAHY 1142
SQPFAHY
Sbjct: 1220 SQPFAHY 1226
|
|
| UNIPROTKB|E1C0J4 UPF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107995 Upf1 "UPF1 regulator of nonsense transcripts homolog (yeast)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2836 upf1 "upf1 regulator of nonsense transcripts homolog (yeast)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C0J3 UPF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92900 UPF1 "Regulator of nonsense transcripts 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BEK9 UPF1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RL81 UPF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4ND47 MGG_00976 "Regulator-nonsense transcripts 1" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0030354 Upf1 "Upf1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9FJR0 | RENT1_ARATH | 3, ., 6, ., 4, ., - | 0.8424 | 0.7617 | 0.7113 | yes | no |
| Q92900 | RENT1_HUMAN | 3, ., 6, ., 4, ., - | 0.5894 | 0.6456 | 0.6696 | yes | no |
| Q9EPU0 | RENT1_MOUSE | 3, ., 6, ., 4, ., - | 0.5890 | 0.6421 | 0.6690 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.6.4.12 | LOW CONFIDENCE prediction! |
| 3rd Layer | 3.6.4 | 0.691 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1171 | |||
| COG1112 | 767 | COG1112, COG1112, Superfamily I DNA and RNA helica | 1e-101 | |
| TIGR00376 | 637 | TIGR00376, TIGR00376, DNA helicase, putative | 2e-87 | |
| pfam13087 | 195 | pfam13087, AAA_12, AAA domain | 1e-81 | |
| pfam13086 | 220 | pfam13086, AAA_11, AAA domain | 1e-71 | |
| pfam09416 | 152 | pfam09416, UPF1_Zn_bind, RNA helicase (UPF2 intera | 4e-64 | |
| pfam13245 | 73 | pfam13245, AAA_19, Part of AAA domain | 7e-12 | |
| TIGR01447 | 586 | TIGR01447, recD, exodeoxyribonuclease V, alpha sub | 5e-09 | |
| pfam13604 | 195 | pfam13604, AAA_30, AAA domain | 1e-08 | |
| pfam04851 | 100 | pfam04851, ResIII, Type III restriction enzyme, re | 6e-08 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 1e-07 | |
| cd00046 | 144 | cd00046, DEXDc, DEAD-like helicases superfamily | 1e-06 | |
| TIGR01448 | 720 | TIGR01448, recD_rel, helicase, putative, RecD/TraA | 1e-05 | |
| PRK10875 | 615 | PRK10875, recD, exonuclease V subunit alpha; Provi | 1e-04 | |
| COG1061 | 442 | COG1061, SSL2, DNA or RNA helicases of superfamily | 2e-04 | |
| TIGR00643 | 630 | TIGR00643, recG, ATP-dependent DNA helicase RecG | 0.002 | |
| COG1199 | 654 | COG1199, DinG, Rad3-related DNA helicases [Transcr | 0.002 | |
| TIGR00959 | 428 | TIGR00959, ffh, signal recognition particle protei | 0.003 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 0.003 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 0.004 |
| >gnl|CDD|224037 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Score = 338 bits (869), Expect = e-101
Identities = 170/598 (28%), Positives = 263/598 (43%), Gaps = 32/598 (5%)
Query: 248 DNVTIRWDIGLNKKRVAYFVFP-KEDNELR-------LVPGDELRLRYSGDAAHPAWQSV 299
+ I + L K P E E+R L + + LR + + +
Sbjct: 182 AGLLIEYLKRLRKVLDKIIPPPLFEKEEVRVDIVENLLELSESILLRRELELLS-KFALI 240
Query: 300 GHVIKLTAQEEVALELRASQG---VPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDE-T 355
+ L + E+ V +++ + + R+ F + +
Sbjct: 241 LKRL-LESLFEILRGKDLPIKLLDVELELVEINKELDNEQKLAVKRLLSLNDLFLIHQGP 299
Query: 356 SVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPG 415
+G + + + N L A ++ ++V++ + I P
Sbjct: 300 FGTGKTRSVTILELIIELLENNKLKILPTAESNAAVDNLLRRLKRTVIKVELLRIGHPSR 359
Query: 416 TGKTVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSP 475
K + + + K + A +D++ ++ G +++R AK RE +
Sbjct: 360 VLKKLKLDTLEELLEKHEIPGNKIAA-----LDKVIRELREEGERIIREIAKLRERLERK 414
Query: 476 VEHLTLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVI 535
H V K + L E K+ + LK+ +I ++ADV+
Sbjct: 415 RLDKISHLNVALRGILPALN--KSEALWISLEEKQKKILKELRRLKKKAVTKILEAADVV 472
Query: 536 CCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCK 595
T AG L + F V+IDE++QATEP LI L AK+V+LVGDH QL P + K
Sbjct: 473 LSTLSIAGFSILKKYEFDYVIIDEASQATEPSALIALSR-AKKVILVGDHKQLPPTVFFK 531
Query: 596 KAARAGLAQSLFERLVLLGL-KPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQS 654
+++ GL+ SLFERL+ G L+VQYRMHP + F S FY G L+ +
Sbjct: 532 ESSPEGLSASLFERLIDNGPEVVYLLRVQYRMHPDIIAFSSKVFYNGRLEVHTSFLAFTL 591
Query: 655 SGIDFPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGV 714
+ P V + P+ FY +G EE S S LN EA V+ IV L+ G+ + IGV
Sbjct: 592 LDGEIPEVVISNPLEFYDTLGAEEFFES-KSKLNELEAEIVKVIVDELLKDGLEENDIGV 650
Query: 715 ITPYEGQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSN-EHQGIG 773
I+PY Q + I ++ G K +EV +VD FQGREKD IILS VRSN + IG
Sbjct: 651 ISPYRAQVSLIRRLLNEAG-------KGVEVGTVDGFQGREKDVIILSLVRSNDDKGEIG 703
Query: 774 FLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQS 831
FL DPRRLNVALTRA+ ++++G+ L PL+ L+ K L E L +L+ +
Sbjct: 704 FLGDPRRLNVALTRAKRKLIVVGSSSTLESDPLYKRLINDLKRKGLLAELNLLDLRLT 761
|
Length = 767 |
| >gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|221913 pfam13087, AAA_12, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221912 pfam13086, AAA_11, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|192286 pfam09416, UPF1_Zn_bind, RNA helicase (UPF2 interacting domain) | Back alignment and domain information |
|---|
| >gnl|CDD|222005 pfam13245, AAA_19, Part of AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|233417 TIGR01447, recD, exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|222258 pfam13604, AAA_30, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|233418 TIGR01448, recD_rel, helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >gnl|CDD|236783 PRK10875, recD, exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >gnl|CDD|224120 COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233210 TIGR00959, ffh, signal recognition particle protein | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1171 | |||
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 100.0 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 100.0 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 100.0 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 100.0 | |
| KOG1807 | 1025 | consensus Helicases [Replication, recombination an | 100.0 | |
| COG1112 | 767 | Superfamily I DNA and RNA helicases and helicase s | 100.0 | |
| PF09416 | 152 | UPF1_Zn_bind: RNA helicase (UPF2 interacting domai | 100.0 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 100.0 | |
| KOG1801 | 827 | consensus tRNA-splicing endonuclease positive effe | 100.0 | |
| PF13087 | 200 | AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP | 100.0 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 99.97 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 99.97 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 99.97 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 99.96 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 99.96 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 99.96 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 99.96 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 99.96 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 99.95 | |
| KOG1806 | 1320 | consensus DEAD box containing helicases [Replicati | 99.94 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 99.94 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 99.91 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 99.91 | |
| TIGR00609 | 1087 | recB exodeoxyribonuclease V, beta subunit. All pro | 99.89 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 99.89 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 99.89 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 99.89 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 99.88 | |
| PRK13909 | 910 | putative recombination protein RecB; Provisional | 99.87 | |
| PRK10876 | 1181 | recB exonuclease V subunit beta; Provisional | 99.85 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 99.84 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 99.78 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 99.78 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 99.77 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 99.71 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 99.69 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 99.66 | |
| COG0507 | 696 | RecD ATP-dependent exoDNAse (exonuclease V), alpha | 99.58 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 99.57 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 99.54 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 99.5 | |
| COG3972 | 660 | Superfamily I DNA and RNA helicases [General funct | 99.44 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 99.3 | |
| PF13361 | 351 | UvrD_C: UvrD-like helicase C-terminal domain; PDB: | 99.28 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 99.2 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 98.88 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 98.86 | |
| TIGR02773 | 1158 | addB_Gpos ATP-dependent nuclease subunit B. DNA re | 98.77 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 98.75 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 98.65 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 98.57 | |
| PF13538 | 104 | UvrD_C_2: UvrD-like helicase C-terminal domain; PD | 98.55 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 98.54 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 98.41 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 98.35 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 98.32 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 98.3 | |
| KOG2108 | 853 | consensus 3'-5' DNA helicase [Replication, recombi | 98.29 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 98.25 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 98.19 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 98.14 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 98.11 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 98.1 | |
| PTZ00424 | 401 | helicase 45; Provisional | 98.05 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 98.0 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 97.99 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 97.96 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 97.96 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 97.95 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 97.94 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 97.93 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 97.88 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 97.82 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 97.78 | |
| PTZ00110 | 545 | helicase; Provisional | 97.75 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 97.74 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 97.71 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 97.68 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 97.68 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 97.61 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 97.6 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 97.57 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 97.55 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 97.53 | |
| COG1702 | 348 | PhoH Phosphate starvation-inducible protein PhoH, | 97.51 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 97.5 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 97.5 | |
| PRK08181 | 269 | transposase; Validated | 97.49 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 97.45 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 97.44 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 97.4 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 97.39 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 97.37 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.37 | |
| PRK06526 | 254 | transposase; Provisional | 97.35 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 97.35 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 97.35 | |
| PF05127 | 177 | Helicase_RecD: Helicase; InterPro: IPR007807 This | 97.34 | |
| KOG2108 | 853 | consensus 3'-5' DNA helicase [Replication, recombi | 97.33 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 97.32 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 97.32 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 97.32 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 97.32 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 97.31 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 97.31 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 97.3 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 97.28 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 97.24 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 97.24 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 97.23 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 97.19 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 97.18 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 97.16 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 97.15 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 97.09 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 97.08 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 97.06 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 97.01 | |
| KOG0354 | 746 | consensus DEAD-box like helicase [General function | 97.0 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 96.97 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 96.93 | |
| PF13173 | 128 | AAA_14: AAA domain | 96.89 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.87 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 96.87 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 96.83 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 96.81 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 96.78 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.75 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 96.74 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 96.73 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 96.71 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.71 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 96.71 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.7 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 96.7 | |
| PHA03311 | 828 | helicase-primase subunit BBLF4; Provisional | 96.69 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 96.68 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 96.63 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.61 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.61 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 96.6 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 96.51 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.49 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.49 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 96.44 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 96.42 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 96.4 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 96.39 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 96.37 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 96.32 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 96.3 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 96.29 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 96.28 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 96.28 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 96.2 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 96.14 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 96.1 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.08 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 96.06 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 96.06 | |
| KOG0987 | 540 | consensus DNA helicase PIF1/RRM3 [Cell cycle contr | 96.02 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 96.01 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 95.93 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 95.92 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 95.87 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 95.84 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 95.81 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 95.81 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 95.79 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 95.78 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 95.72 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 95.71 | |
| KOG0330 | 476 | consensus ATP-dependent RNA helicase [RNA processi | 95.71 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 95.63 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 95.61 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 95.61 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 95.56 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 95.54 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 95.52 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 95.51 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 95.49 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 95.45 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 95.44 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 95.42 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 95.41 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 95.31 | |
| KOG0333 | 673 | consensus U5 snRNP-like RNA helicase subunit [RNA | 95.31 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 95.31 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 95.29 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 95.28 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 95.27 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 95.26 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 95.25 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 95.25 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 95.24 | |
| PRK08116 | 268 | hypothetical protein; Validated | 95.2 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 95.2 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 95.17 | |
| TIGR02774 | 1076 | rexB_recomb ATP-dependent nuclease subunit B. DNA | 95.15 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 95.14 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 95.1 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 95.1 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 95.1 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 95.08 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 95.03 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 95.02 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 95.02 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 95.02 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 94.96 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 94.94 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 94.94 | |
| KOG0335 | 482 | consensus ATP-dependent RNA helicase [RNA processi | 94.93 | |
| PHA03333 | 752 | putative ATPase subunit of terminase; Provisional | 94.93 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 94.92 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 94.88 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 94.88 | |
| KOG0922 | 674 | consensus DEAH-box RNA helicase [RNA processing an | 94.87 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 94.84 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 94.83 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 94.81 | |
| COG0507 | 696 | RecD ATP-dependent exoDNAse (exonuclease V), alpha | 94.81 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 94.8 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 94.8 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 94.79 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 94.76 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 94.73 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 94.73 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 94.73 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.71 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 94.65 | |
| PF02689 | 818 | Herpes_Helicase: Helicase; InterPro: IPR003840 Thi | 94.65 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 94.65 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 94.64 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 94.6 | |
| PF05729 | 166 | NACHT: NACHT domain | 94.52 | |
| KOG0339 | 731 | consensus ATP-dependent RNA helicase [RNA processi | 94.5 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 94.45 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 94.42 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 94.41 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 94.41 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 94.41 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 94.41 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 94.39 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 94.39 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 94.37 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 94.36 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 94.33 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 94.33 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 94.32 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 94.31 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 94.22 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 94.11 | |
| PRK08727 | 233 | hypothetical protein; Validated | 94.11 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 94.1 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 94.09 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 94.04 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 94.03 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 93.95 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 93.93 | |
| KOG0780 | 483 | consensus Signal recognition particle, subunit Srp | 93.93 | |
| KOG0342 | 543 | consensus ATP-dependent RNA helicase pitchoune [RN | 93.91 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 93.88 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 93.83 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 93.82 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 93.81 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 93.76 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 93.74 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 93.69 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 93.69 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 93.63 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 93.62 | |
| PHA00350 | 399 | putative assembly protein | 93.62 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 93.59 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 93.58 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 93.57 | |
| PHA03368 | 738 | DNA packaging terminase subunit 1; Provisional | 93.57 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 93.57 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 93.54 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 93.54 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 93.52 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 93.52 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 93.52 | |
| KOG4284 | 980 | consensus DEAD box protein [Transcription] | 93.47 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 93.45 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 93.44 | |
| KOG0923 | 902 | consensus mRNA splicing factor ATP-dependent RNA h | 93.43 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 93.37 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 93.33 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 93.31 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 93.25 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 93.24 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 93.21 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 93.2 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 93.19 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 93.05 | |
| KOG0331 | 519 | consensus ATP-dependent RNA helicase [RNA processi | 93.0 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 92.92 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 92.92 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 92.84 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 92.8 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 92.79 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 92.72 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 92.71 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 92.7 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 92.68 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 92.68 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 92.57 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 92.54 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 92.44 | |
| KOG0345 | 567 | consensus ATP-dependent RNA helicase [RNA processi | 92.37 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 92.37 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 92.35 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 92.29 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 92.28 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 92.28 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 92.26 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 92.2 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 92.18 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 92.15 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 92.11 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 92.06 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 92.04 | |
| PRK13768 | 253 | GTPase; Provisional | 91.99 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 91.97 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 91.93 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 91.82 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 91.82 | |
| KOG1131 | 755 | consensus RNA polymerase II transcription initiati | 91.75 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 91.74 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 91.74 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 91.74 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 91.69 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 91.68 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 91.67 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 91.64 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 91.63 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 91.6 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 91.53 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 91.52 | |
| KOG0389 | 941 | consensus SNF2 family DNA-dependent ATPase [Chroma | 91.51 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 91.47 | |
| KOG0781 | 587 | consensus Signal recognition particle receptor, al | 91.44 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 91.39 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 91.38 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 91.3 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 91.25 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 91.22 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 91.22 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 91.18 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 91.14 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 91.05 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 90.93 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 90.93 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 90.89 | |
| KOG0348 | 708 | consensus ATP-dependent RNA helicase [RNA processi | 90.86 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 90.86 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 90.82 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 90.78 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 90.71 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 90.7 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 90.6 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 90.6 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 90.59 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 90.51 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 90.47 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 90.44 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 90.42 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 90.4 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 90.39 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 90.28 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 90.27 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 90.22 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 90.2 | |
| KOG0390 | 776 | consensus DNA repair protein, SNF2 family [Replica | 90.19 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 90.19 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 90.18 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 90.17 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 90.16 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 90.15 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 90.13 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 90.12 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 90.09 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 90.05 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 90.05 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 89.91 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 89.89 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 89.81 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 89.75 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 89.71 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 89.65 | |
| KOG0328 | 400 | consensus Predicted ATP-dependent RNA helicase FAL | 89.64 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 89.64 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 89.64 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 89.62 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 89.61 | |
| KOG0385 | 971 | consensus Chromatin remodeling complex WSTF-ISWI, | 89.57 | |
| KOG0926 | 1172 | consensus DEAH-box RNA helicase [RNA processing an | 89.57 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 89.54 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 89.53 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 89.53 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 89.5 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 89.47 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 89.4 | |
| PRK03839 | 180 | putative kinase; Provisional | 89.37 | |
| PRK07667 | 193 | uridine kinase; Provisional | 89.35 | |
| KOG0338 | 691 | consensus ATP-dependent RNA helicase [RNA processi | 89.34 | |
| PHA02244 | 383 | ATPase-like protein | 89.33 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 89.17 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 89.14 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 89.11 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 89.08 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 89.04 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 89.03 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 89.02 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 88.95 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 88.94 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 88.91 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 88.89 | |
| PRK06696 | 223 | uridine kinase; Validated | 88.8 | |
| COG3857 | 1108 | AddB ATP-dependent nuclease, subunit B [DNA replic | 88.76 | |
| COG3911 | 183 | Predicted ATPase [General function prediction only | 88.74 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 88.73 | |
| cd00550 | 254 | ArsA_ATPase Oxyanion-translocating ATPase (ArsA). | 88.72 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 88.68 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 88.67 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 88.64 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 88.64 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 88.62 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 88.62 | |
| PRK13764 | 602 | ATPase; Provisional | 88.58 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 88.56 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 88.49 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 88.47 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 88.42 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 88.4 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 88.39 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 88.32 | |
| PF01656 | 195 | CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai | 88.26 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 88.24 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 88.23 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 88.2 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 88.2 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 88.18 | |
| PRK06620 | 214 | hypothetical protein; Validated | 88.14 | |
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 88.14 | |
| PLN02200 | 234 | adenylate kinase family protein | 88.07 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 88.05 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 87.98 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 87.97 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 87.95 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 87.93 | |
| PRK14494 | 229 | putative molybdopterin-guanine dinucleotide biosyn | 87.84 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 87.8 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 87.8 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 87.73 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 87.7 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 87.7 | |
| KOG0924 | 1042 | consensus mRNA splicing factor ATP-dependent RNA h | 87.67 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 87.49 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 87.48 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 87.46 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 87.45 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 87.34 | |
| KOG0346 | 569 | consensus RNA helicase [RNA processing and modific | 87.34 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 87.33 | |
| PHA02624 | 647 | large T antigen; Provisional | 87.33 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 87.32 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 87.29 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 87.28 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 87.26 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 87.25 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 87.23 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 87.18 | |
| PRK13235 | 274 | nifH nitrogenase reductase; Reviewed | 87.14 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 87.07 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 87.04 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 86.94 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 86.92 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 86.84 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 86.79 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 86.74 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 86.67 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 86.65 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 86.64 | |
| TIGR02016 | 296 | BchX chlorophyllide reductase iron protein subunit | 86.62 | |
| KOG0337 | 529 | consensus ATP-dependent RNA helicase [RNA processi | 86.58 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 86.56 | |
| TIGR01287 | 275 | nifH nitrogenase iron protein. This model describe | 86.54 | |
| cd02035 | 217 | ArsA ArsA ATPase functionas as an efflux pump loca | 86.5 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 86.42 | |
| CHL00072 | 290 | chlL photochlorophyllide reductase subunit L | 86.38 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 86.37 | |
| TIGR01281 | 268 | DPOR_bchL light-independent protochlorophyllide re | 86.34 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 86.31 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 86.3 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 86.3 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 86.27 | |
| cd03112 | 158 | CobW_like The function of this protein family is u | 86.27 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 86.09 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 86.04 |
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7e-177 Score=1511.02 Aligned_cols=791 Identities=68% Similarity=1.098 Sum_probs=739.8
Q ss_pred cccccccccCCCccCcccCCccCCcccccccCCCCCCceeecCCCCcCceeeCCCCCCCcchhhhhHhhcccceeeecCC
Q 001054 118 MAGLSFEETGDDVEGFEYGKADFTEHACRYCGVSNPACVVRCNVPSCRKWFCNSRGNTSGSHIVNHLVRAKHKEVCLHKD 197 (1171)
Q Consensus 118 ~~~~~~~~~~~~~~~~~~~~~~~~~~~c~yc~~~~~~~~~~c~~~~~~~wfcn~~~~~~~shi~~hl~~~~~~~~~lh~~ 197 (1171)
+.++.|||-..+. .... +.++|+|+|+||||++|.||++|++ |+|||||+|++|+|||||+||||++||+|+||+|
T Consensus 38 ~~e~~fee~~~~~-~~~~-~~~~~~~~c~Ycgi~~p~~v~kc~~--c~Kwfcn~r~gtsgshIv~hlvra~hk~v~lh~d 113 (935)
T KOG1802|consen 38 VGEVLFEECLVEK-NRAR-EQKLPEHACAYCGISEPACVIKCNT--CGKWFCNSRGGTSGSHIVNHLVRAKHKEVSLHKD 113 (935)
T ss_pred cchhhhhhhcccc-cccc-ccccchhhhhhccCCCchheeeccc--cCceeecCCCCCchhHHHHHHHHhhhheeEeccC
Confidence 8899999865552 3334 4589999999999999999999998 9999999999999999999999999999999999
Q ss_pred CCCcccchhhccccCcccccccceeccCCCeEEEEcchHHHH--------------------------------------
Q 001054 198 SPLGETILECYNCGCRNVFLLGFISAKTESVVVLLCREPCLN-------------------------------------- 239 (1171)
Q Consensus 198 ~~~~~~~l~cy~c~~~n~f~lg~~~~~~~~~~v~lcr~~c~~-------------------------------------- 239 (1171)
+++|||+||||+||++|||+|||||+|+|+|||++||+||++
T Consensus 114 s~lget~lecyncg~~nvf~lGFi~~ksd~VVvllcr~pcas~s~~kd~Nwd~~qw~~li~dr~~l~wivk~pseqe~~~ 193 (935)
T KOG1802|consen 114 SPLGETVLECYNCGSRNVFLLGFIPAKSDSVVVLLCRQPCASRSNLKDMNWDLSQWQPLIEDRCLLSWIVKVPSEQEQLR 193 (935)
T ss_pred CCCCcceEEeeccCcchhhhhcccccccCceEEEEecCcccccccCCCcCCChhhccchhhhhcccchhccCCcchhhhh
Confidence 999999999999999999999999999999999999999986
Q ss_pred -----------------------------------------------------------------HhhhccccccEEEEE
Q 001054 240 -----------------------------------------------------------------MMKESQSKDNVTIRW 254 (1171)
Q Consensus 240 -----------------------------------------------------------------~~ke~~~~~~i~~r~ 254 (1171)
.+||+|++++++|||
T Consensus 194 aR~iT~qqi~~~eelwr~np~at~~dl~kP~~d~~~~hv~~ry~da~~y~~vf~pliklea~ydk~~Kes~~q~~~tvRW 273 (935)
T KOG1802|consen 194 ARKITAQQIVKLEELWRKNPSATLEDLDKPGEDEEPPHVQLRYEDAYEYQNVFSPLIKLEADYDKRLKESQTQENGTVRW 273 (935)
T ss_pred hccccHHHHHHHHhhhccCCccchhhcCCcccccCCCcccccccchHHHhhhcchhhhhhhhhhhhhhhhcccccceEEe
Confidence 889999999999999
Q ss_pred EeccCCeEEEEEEccCCCCCCCCCCCCEEEEEecCCCCCCcceEEEEEEEecc--ccEEEEEeccCCCCCcccCCCceEE
Q 001054 255 DIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSVGHVIKLTA--QEEVALELRASQGVPVDINHGFSVD 332 (1171)
Q Consensus 255 ~~~l~~k~~~~~~~~~~~~~~~l~~GD~v~l~~~g~~~~~~~~~~G~V~ki~~--~~~v~l~l~~~~~~p~~~~~~~~v~ 332 (1171)
+++||+|+++||.+++-+.++++..||+++|+|++. ....|.++|+|+++++ ++|+.||++.....|.+.+++|+|+
T Consensus 274 ~~gLnkk~~a~f~~~k~~~e~kl~~GdE~~L~y~~~-~~~~w~~~g~v~~~pd~~~dE~~lEl~~~~~~p~e~~~~Ftvd 352 (935)
T KOG1802|consen 274 DIGLNKKRLAYFTLPKLDSELKLAIGDEIRLTYSGG-LVLPWNGIGSVLKIPDNNGDEVKLELEFSQDPPIEVTHGFTVD 352 (935)
T ss_pred eeccccceEEEEecCCCcchhccccCCeeEEEecCC-cCCcccccceEEecCCCCcceeEEEeecCCCCCcccccceEEE
Confidence 999999999999999999999999999999999998 5555999999999998 6999999999989999999999999
Q ss_pred EecccchHHHHHHHHHHHHHhhhhhhhhHHhhhcCCchhhhhhhccCCcccCCCCCCCCCHHHHHHHHHhhcCCcEEEEc
Q 001054 333 FVWKSTSFDRMQGAMKTFAVDETSVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQG 412 (1171)
Q Consensus 333 ~~~~~~s~~Rm~~AL~~~~~~e~~vs~~I~~~llg~~~~~~~~~~~lp~~f~~p~l~~LNesQ~~AV~~aL~~~lsLIqG 412 (1171)
++|+.++|+||+.||+.|+.|+.+++.|+|+.+||+++++..++..||++|+.+++++||.+|..||+++|+++++||||
T Consensus 353 ~vwk~ts~drm~~alk~la~D~~~vs~y~y~klLgh~~~~~~~k~~LP~~~s~~~lpkLN~SQ~~AV~~VL~rplsLIQG 432 (935)
T KOG1802|consen 353 FVWKSTSFDRMQLALKLLAVDEKKVSGYLYHKLLGHPVEDSSLKKLLPRRFSVPNLPKLNASQSNAVKHVLQRPLSLIQG 432 (935)
T ss_pred EEEcCccHHHHHHHHHHhhhccccchhhhhhHHhcCcchhhhhcccCchhhcCCCchhhchHHHHHHHHHHcCCceeeec
Confidence 99999999999999999999999999999999999999998899999999999999999999999999999999999999
Q ss_pred CCCChHhHHHHHHHHHHHHcCCCcEEEEcCcHHHHHHHHHHHHhcCCeEEEeccccccccCCcchhhhHHHHHhhccchh
Q 001054 413 PPGTGKTVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRHLDTSE 492 (1171)
Q Consensus 413 PPGTGKTtTla~iI~~Llk~~~~rILV~ApSN~AVD~L~eRL~~~glkVVRlg~~sre~i~~~v~~l~L~~~i~~l~~~~ 492 (1171)
|||||||.|+++||++|+++...+||||||||.|||+|+|+|++.|++|||+++++||.++++++++++|.+++.+..
T Consensus 433 PPGTGKTvtsa~IVyhl~~~~~~~VLvcApSNiAVDqLaeKIh~tgLKVvRl~aksRE~~~S~vs~L~lh~~~~~~~~-- 510 (935)
T KOG1802|consen 433 PPGTGKTVTSATIVYHLARQHAGPVLVCAPSNIAVDQLAEKIHKTGLKVVRLCAKSREDIESDVSFLSLHEQLRNMDK-- 510 (935)
T ss_pred CCCCCceehhHHHHHHHHHhcCCceEEEcccchhHHHHHHHHHhcCceEeeeehhhhhhccCCccHHHHHHHHhccCc--
Confidence 999999999999999999998889999999999999999999999999999999999999999999999999999886
Q ss_pred HHHHHHHHhhhhhhccCCchHHHHHHHHHHHHHHHHHhccccccccccccCCCCcccCCCCEEEEEcCCCCCcccccccc
Q 001054 493 KSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPL 572 (1171)
Q Consensus 493 ~~~L~kL~~lk~e~~els~~dek~y~~l~r~~e~~iL~~a~VI~~T~~~a~~~~L~~~kFD~VIIDEASQasEpe~LIpL 572 (1171)
.+|+++.+++++.++++..++++|+.+++..+++++..|+||||||++|++.+|.+++|..||||||.|++||++||||
T Consensus 511 -pELq~l~klkde~gelS~sD~~k~~~lk~~~e~ell~~AdVIccTcv~Agd~rl~~~kfr~VLiDEaTQatEpe~LiPl 589 (935)
T KOG1802|consen 511 -PELQKLLKLKDEGGELSSSDEKKYRKLKRAAEKELLNQADVICCTCVGAGDRRLSKFKFRTVLIDEATQATEPECLIPL 589 (935)
T ss_pred -HHHHHHHhhhhhcccccchhhHHHHHHHHHHHHHHHhhcCEEEEecccccchhhccccccEEEEecccccCCcchhhhh
Confidence 7899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccCceEEEeCCccCCCceeecHHHHhhcchHHHHHHHHHcCCccEEeeeeccCCCCCCcccccccccCccccccccccc
Q 001054 573 VLGAKQVVLVGDHCQLGPVIMCKKAARAGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINER 652 (1171)
Q Consensus 573 ~~~~kkLILVGD~~QLpPvv~s~~a~~~gl~~SLFERL~~~g~~~i~L~~qYRmhp~I~~f~S~lFY~g~L~~~~~~~~r 652 (1171)
+++++++||||||+||+|++++++++.++|.+||||||+..|..+++|.+||||||.|++|++++||+|.|+++++..+|
T Consensus 590 vlG~kq~VlVGDh~QLgpvi~~kK~a~Agl~qsLferli~lg~~P~~L~vQYRmhP~lSefpsn~fY~G~LqnGVT~~~R 669 (935)
T KOG1802|consen 590 VLGAKQLVLVGDHKQLGPVIMCKKAATAGLSQSLFERLISLGIKPIRLQVQYRMHPALSEFPSNMFYEGELQNGVTEIER 669 (935)
T ss_pred hhcceeEEEeccccccCceeeeHHHHHhHHHHHHHHHHHhccCCceEEEEeeeeChhhhhcchhhhccchhhcCcchhhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCCCCCCCCCCCCCeEEEEcCCceeecccCCcccCHHHHHHHHHHHHHHHHcCCCCCcEEEEecchhHHHHHHHHHHhc
Q 001054 653 QSSGIDFPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYEGQRAYIVNYMSRN 732 (1171)
Q Consensus 653 ~l~~~~~~~p~~~~Pvif~~~~G~ee~~~~g~S~~N~~EA~~V~~iV~~Llk~Gv~~~dIGIITPY~aQv~~I~~~L~~~ 732 (1171)
...++.++||.++.|++|+...|.|+++.+|+||.|+.||..++++|+.|++.|+.+++|||||||.+|+.+|.++|...
T Consensus 670 ~~~g~~~pwp~p~~pl~fy~~~g~eeisasGtSf~Nr~Ea~~~ekii~~l~~~gv~~~qIGVITpYegQr~~i~~ym~~~ 749 (935)
T KOG1802|consen 670 SPLGVDFPWPQPDKPLFFYVCYGQEEISASGTSFLNRTEAANCEKIITKLLKSGVKPSQIGVITPYEGQRSYIVNYMQTN 749 (935)
T ss_pred ccCCCCCCCCCCCCccceEEeccceeeeccccceecHHHHHHHHHHHHHHHHcCCCHHHeeeecccchhHHHHHHHHHhc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cchhhhcCCCeEEecccCcccCccCeEEEeccccCCcCCcCCCCCcCceeeechhhccceEEEecccccccCchHHHHHH
Q 001054 733 GALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLT 812 (1171)
Q Consensus 733 g~l~~~~~~~V~V~TVdsfQG~E~DvVILS~VRSn~~~~iGFL~D~RRLNVALTRAK~~LIIVGn~~~Ls~~~~W~~Ll~ 812 (1171)
+.+...++..|+|+|||+|||+|+|+||+||||+|...+|||+.|+|||||||||||++|+||||+.+|+++++|.+||.
T Consensus 750 gsl~~~ly~~veVasVDaFQGrEKdfIIlSCVRsn~~qgIGFl~d~RRlNVaLTRaK~glvivGN~~~L~k~~LW~~li~ 829 (935)
T KOG1802|consen 750 GSLHKDLYKEVEVASVDAFQGREKDFIILSCVRSNEHQGIGFLNDPRRLNVALTRAKYGLVIVGNPKVLRKHPLWGHLIT 829 (935)
T ss_pred CccccchhheeEEEeeccccCcccceEEEEEeecccccccccccCchhhhhhhhhcccceEEecCHHHhhhchHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHhcCceecCCCcchhhhhhccccCcccccccccccCCCCCCcCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 001054 813 HYKEHECLVEGPLNNLKQSMVQFQKPKKIYNDRRLFFGAGPGIVPND-ISTSNPNADRRGSRARGYMPPGPPNGTHKPGL 891 (1171)
Q Consensus 813 ~~ke~~~lv~g~l~~l~~s~~~~~~p~~~~~~~~~~~g~g~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 891 (1171)
||++++++++|++++++++++++.+|+++.+.++...+......-.+ ....++.+..+.++...|.....+.+..
T Consensus 830 h~~eke~l~eg~ln~l~~~~~~l~kp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~y~~~~n~~~~~---- 905 (935)
T KOG1802|consen 830 HYKEKEVLVEGPLNNLKPSLLQLLKPQKLKNFKEKQKGFMNKSKIKDKSHSFNPSASNRPSRLSSYLNSGNLFGMS---- 905 (935)
T ss_pred HhhcccceeecchhhhhhhhhhhcCCchhhhhhhhhhhhhhhcccccccccCCcchhccccccchhccccCccccc----
Confidence 99999999999999999999999999999988776554433222222 2233455555555554554444433322
Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 001054 892 HPAGFPMPRVPLPPFQGGPPSQPYAIPSR 920 (1171)
Q Consensus 892 ~~~~~~~p~~p~p~~~g~~~~~p~~~~~~ 920 (1171)
.++.+..+..|.|+...+|+.++++.+.+
T Consensus 906 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 934 (935)
T KOG1802|consen 906 KLAQYFNKNVPIPANMVGPPSQKAARNTR 934 (935)
T ss_pred ChhhccccCCCCchhhcCCCcccccccCC
Confidence 25566667778888888888888755543
|
|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1807 consensus Helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF09416 UPF1_Zn_bind: RNA helicase (UPF2 interacting domain); InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13087 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A 2XZL_A | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >TIGR00609 recB exodeoxyribonuclease V, beta subunit | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13909 putative recombination protein RecB; Provisional | Back alignment and domain information |
|---|
| >PRK10876 recB exonuclease V subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >COG3972 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PF13361 UvrD_C: UvrD-like helicase C-terminal domain; PDB: 1UAA_B 3U4Q_A 3U44_A 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02773 addB_Gpos ATP-dependent nuclease subunit B | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PF13538 UvrD_C_2: UvrD-like helicase C-terminal domain; PDB: 1W36_G 3K70_G 3DMN_A 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase | Back alignment and domain information |
|---|
| >KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >KOG0354 consensus DEAD-box like helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PHA03311 helicase-primase subunit BBLF4; Provisional | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0987 consensus DNA helicase PIF1/RRM3 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >TIGR02774 rexB_recomb ATP-dependent nuclease subunit B | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PHA03333 putative ATPase subunit of terminase; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF02689 Herpes_Helicase: Helicase; InterPro: IPR003840 This entry consists of DNA helicases from a number of different organisms | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PHA00350 putative assembly protein | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PHA03368 DNA packaging terminase subunit 1; Provisional | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >KOG4284 consensus DEAD box protein [Transcription] | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >COG3857 AddB ATP-dependent nuclease, subunit B [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG3911 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0346 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13235 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >TIGR02016 BchX chlorophyllide reductase iron protein subunit X | Back alignment and domain information |
|---|
| >KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01287 nifH nitrogenase iron protein | Back alignment and domain information |
|---|
| >cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >CHL00072 chlL photochlorophyllide reductase subunit L | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >cd03112 CobW_like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1171 | ||||
| 2gjk_A | 624 | Structural And Functional Insights Into The Human U | 0.0 | ||
| 2xzo_A | 623 | Upf1 Helicase - Rna Complex Length = 623 | 0.0 | ||
| 2wjv_A | 800 | Crystal Structure Of The Complex Between Human Nons | 0.0 | ||
| 2xzl_A | 802 | Upf1-Rna Complex Length = 802 | 0.0 | ||
| 4b3g_A | 646 | Crystal Structure Of Ighmbp2 Helicase In Complex Wi | 7e-48 | ||
| 4b3f_X | 646 | Crystal Structure Of 1ghmbp2 Helicase Length = 646 | 7e-48 | ||
| 2iyk_A | 162 | Crystal Structure Of The Upf2-Interacting Domain Of | 1e-42 |
| >pdb|2GJK|A Chain A, Structural And Functional Insights Into The Human Upf1 Helicase Core Length = 624 | Back alignment and structure |
|
| >pdb|2XZO|A Chain A, Upf1 Helicase - Rna Complex Length = 623 | Back alignment and structure |
| >pdb|2WJV|A Chain A, Crystal Structure Of The Complex Between Human Nonsense Mediated Decay Factors Upf1 And Upf2 Length = 800 | Back alignment and structure |
| >pdb|2XZL|A Chain A, Upf1-Rna Complex Length = 802 | Back alignment and structure |
| >pdb|4B3G|A Chain A, Crystal Structure Of Ighmbp2 Helicase In Complex With Rna Length = 646 | Back alignment and structure |
| >pdb|4B3F|X Chain X, Crystal Structure Of 1ghmbp2 Helicase Length = 646 | Back alignment and structure |
| >pdb|2IYK|A Chain A, Crystal Structure Of The Upf2-Interacting Domain Of Nonsense Mediated Mrna Decay Factor Upf1 Length = 162 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 | Back alignment and structure |
|---|
Score = 842 bits (2178), Expect = 0.0
Identities = 428/597 (71%), Positives = 512/597 (85%), Gaps = 5/597 (0%)
Query: 241 MKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSVG 300
+KESQ++DN+T+RWD+GLNKKR+AYF PK D+++RL+ GDE+ LRY GD P W+ +G
Sbjct: 30 LKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSDMRLMQGDEICLRYKGDL-APLWKGIG 88
Query: 301 HVIKL--TAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVS 358
HVIK+ +E+A+ELR+S G PV++ H F VDFVWKSTSFDRMQ A+KTFAVDETSVS
Sbjct: 89 HVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVS 148
Query: 359 GYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGK 418
GYIYH LLGHEVE +++ LP+RF A GLP+LN SQV+AVK+VLQRP+SLIQGPPGTGK
Sbjct: 149 GYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGK 208
Query: 419 TVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEH 478
TVTSA IVYH+A+QG G VLVCAPSN+AVDQL EKI TGLKVVRLCAKSREA+ SPV
Sbjct: 209 TVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSF 268
Query: 479 LTLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCT 538
L LH Q+R + EL KLQQLKDE GELSS+DEK+Y+ALKR ERE+ +ADVICCT
Sbjct: 269 LALHNQIR--NMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCT 326
Query: 539 CVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAA 598
CVGAGDPRLA +FR +LIDESTQATEPEC++P+VLGAKQ++LVGDHCQLGPV+MCKKAA
Sbjct: 327 CVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAA 386
Query: 599 RAGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGID 658
+AGL+QSLFERLV+LG++PIRLQVQYRMHP+LS FPSN FYEG+LQNGVT +R G D
Sbjct: 387 KAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFD 446
Query: 659 FPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPY 718
F WP P++PMFFYV GQEEI++SGTSYLNRTEAANVEKI T L++G P QIG+ITPY
Sbjct: 447 FQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPY 506
Query: 719 EGQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDP 778
EGQR+Y+V YM +G+L +LY+E+E+ASVD+FQGREKD+IILSCVR+NEHQGIGFLNDP
Sbjct: 507 EGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDP 566
Query: 779 RRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQF 835
RRLNVALTRARYG++I+GNPK LSKQPLWN LL +YKE + LVEGPLNNL++S++QF
Sbjct: 567 RRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVEGPLNNLRESLMQF 623
|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Length = 459 | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Length = 608 | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Length = 446 | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Length = 446 | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Length = 574 | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Length = 540 | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1171 | |||
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 100.0 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 100.0 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 100.0 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 100.0 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 99.97 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 99.97 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 99.96 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 99.95 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 99.95 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 99.95 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 99.88 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 99.84 | |
| 1w36_B | 1180 | RECB, exodeoxyribonuclease V beta chain; recombina | 99.84 | |
| 3dmn_A | 174 | Putative DNA helicase; APC89291.2, lactobacillus p | 99.54 | |
| 3u4q_B | 1166 | ATP-dependent helicase/deoxyribonuclease subunit; | 99.27 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 98.63 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 98.62 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 98.6 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 98.58 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 98.57 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 98.56 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 98.54 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 98.51 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 98.51 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 98.51 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 98.5 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 98.46 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 98.44 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 98.44 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 98.43 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 98.42 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 98.41 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 98.4 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 98.38 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 98.36 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 98.35 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 98.35 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 98.33 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 98.32 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 98.31 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 98.27 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 98.26 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.25 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 98.25 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 98.24 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 98.24 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 98.22 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 98.21 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 98.13 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 98.1 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 98.1 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 98.09 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.04 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 98.04 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 98.04 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 98.02 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 98.01 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 97.94 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 97.92 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 97.91 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 97.89 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 97.89 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 97.88 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 97.87 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 97.86 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 97.85 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 97.84 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 97.81 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 97.71 | |
| 2l8b_A | 189 | Protein TRAI, DNA helicase I; RECD, hydrolase; NMR | 97.63 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 97.63 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 97.62 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 97.59 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 97.57 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 97.55 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 97.53 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 97.35 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 97.32 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 97.27 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 97.21 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 97.2 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 97.15 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 97.15 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 97.13 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 97.09 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 97.07 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 97.0 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 96.99 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 96.98 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 96.93 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 96.91 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 96.87 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 96.86 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 96.82 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 96.82 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 96.81 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 96.76 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.61 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 96.53 | |
| 1w36_C | 1122 | RECC, exodeoxyribonuclease V gamma chain; recombin | 96.5 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 96.46 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 96.4 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 96.37 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 96.32 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.95 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 95.88 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 95.78 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 95.59 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 95.43 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 95.29 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 95.21 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 95.17 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 95.15 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 95.12 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 94.93 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 94.93 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 94.78 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 94.69 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 94.62 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 94.5 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 94.38 | |
| 3u4q_B | 1166 | ATP-dependent helicase/deoxyribonuclease subunit; | 94.34 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 94.11 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 94.08 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 94.06 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 93.92 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 93.86 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 93.86 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 93.74 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 93.74 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 93.63 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 93.54 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 93.53 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 93.52 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 93.42 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 93.4 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 93.39 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 93.26 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 93.26 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 93.25 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 93.24 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 93.18 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 93.02 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 92.98 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 92.86 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 92.77 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 92.72 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 92.67 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 92.62 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 92.62 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 92.6 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 92.53 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 92.52 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 92.42 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 92.4 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 92.39 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 92.33 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 92.23 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 92.19 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 92.17 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 92.17 | |
| 3cpe_A | 592 | Terminase, DNA packaging protein GP17; large termi | 92.1 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 92.09 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 92.09 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 92.05 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 92.02 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 92.02 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 92.01 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 92.0 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 91.97 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 91.93 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 91.86 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 91.8 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 91.73 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 91.69 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 91.66 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 91.63 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 91.59 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 91.59 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 91.55 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 91.54 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 91.48 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 91.41 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 91.37 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 91.36 | |
| 2o0j_A | 385 | Terminase, DNA packaging protein GP17; nucleotide- | 91.35 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 91.27 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 91.25 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 91.16 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 91.1 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 91.09 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 91.06 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 91.04 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 91.02 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 91.02 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 91.0 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 90.95 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 90.92 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 90.89 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 90.88 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 90.82 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 90.78 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 90.74 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 90.71 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 90.71 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 90.69 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 90.62 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 90.61 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 90.59 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 90.56 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 90.46 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 90.46 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 90.42 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 90.4 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 90.39 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 90.35 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 90.31 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 90.3 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 90.25 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 90.25 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 90.23 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 90.2 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 90.13 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 90.02 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 90.0 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 89.99 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 89.87 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 89.7 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 89.68 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 89.68 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 89.49 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 89.43 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 89.42 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 89.39 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 89.32 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 89.2 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 89.19 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 89.17 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 89.15 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 89.15 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 89.12 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 89.08 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 89.07 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 89.04 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 89.03 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 88.99 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 88.98 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 88.98 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 88.97 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 88.9 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 88.84 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 88.82 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 88.82 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 88.8 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 88.76 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 88.75 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 88.74 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 88.65 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 88.62 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 88.6 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 88.53 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 88.52 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 88.5 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 88.33 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 88.33 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 88.24 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 88.05 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 88.03 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 88.0 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 87.96 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 87.92 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 87.87 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 87.79 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 87.36 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 87.34 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 87.22 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 87.21 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 87.18 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 87.16 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 87.16 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 87.15 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 87.15 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 87.11 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 87.07 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 87.05 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 87.05 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 87.03 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 87.0 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 86.83 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 86.8 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 86.79 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 86.78 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 86.77 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 86.7 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 86.68 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 86.55 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 86.51 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 86.42 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 86.38 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 86.36 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 86.36 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 86.29 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 86.24 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 86.21 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 86.14 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 86.13 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 85.93 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 85.83 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 85.78 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 85.72 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 85.64 | |
| 1byi_A | 224 | Dethiobiotin synthase; biotin synthesis, cyclo-lig | 85.62 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 85.61 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 85.58 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 85.55 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 85.44 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 85.44 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 85.38 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 85.32 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 85.3 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 85.27 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 85.21 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 85.21 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 85.18 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 84.98 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 84.94 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 84.92 | |
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 84.86 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 84.77 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 84.75 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 84.66 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 84.61 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 84.53 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 84.51 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 84.5 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 84.37 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 84.35 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 84.31 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 84.21 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 84.2 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 84.08 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 84.07 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 83.93 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 83.89 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 83.78 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 83.76 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 83.68 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 83.47 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 83.39 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 83.38 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 83.31 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 83.17 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 83.16 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 82.97 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 82.92 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 82.9 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 82.85 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 82.81 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 82.41 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 82.37 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 82.12 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 82.0 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 81.75 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 81.38 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 81.22 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 81.18 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 81.17 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 80.74 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 80.49 | |
| 3igf_A | 374 | ALL4481 protein; two-domained protein consisting o | 80.29 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 80.25 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 80.22 | |
| 3ez2_A | 398 | Plasmid partition protein A; type IA, DNA binding, | 80.22 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 80.18 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 80.16 |
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-131 Score=1240.63 Aligned_cols=694 Identities=73% Similarity=1.248 Sum_probs=622.9
Q ss_pred ccCCcccccccCCCCCCceeecCCCCcCceeeCCCCCCCcchhhhhHhhcccceeeecCCCCCcccchhhccccCccccc
Q 001054 138 ADFTEHACRYCGVSNPACVVRCNVPSCRKWFCNSRGNTSGSHIVNHLVRAKHKEVCLHKDSPLGETILECYNCGCRNVFL 217 (1171)
Q Consensus 138 ~~~~~~~c~yc~~~~~~~~~~c~~~~~~~wfcn~~~~~~~shi~~hl~~~~~~~~~lh~~~~~~~~~l~cy~c~~~n~f~ 217 (1171)
+++|+|||+|||||+|+|||+|++ |+|||||||++|++||||+||||+|||||+||||+|||||+||||+||+||||+
T Consensus 2 ~~~~~~~c~~c~~~~~~~~~~~~~--~~~~fcn~~~~~~~shi~~h~~~~~~~~~~~~~~~~~~~~~~ec~~c~~~n~f~ 79 (800)
T 2wjy_A 2 KDLPIHACSYCGIHDPACVVYCNT--SKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETVLECYNCGCRNVFL 79 (800)
T ss_dssp CCCCTTSCTTTCCCCGGGEEEETT--TTEEEESCCTTSSSCHHHHHHHHHTCCCEEECTTSTTCSCBCCCTTTCCCCTTT
T ss_pred CCCCchhccccCCCCCCeEEEcCC--CCCccccCCCCCcccHHHHHHHHccCceEecCCCCCCCCceEEEeccCCCceee
Confidence 578999999999999999999999 999999999999999999999999999999999999999999999999999999
Q ss_pred ccceeccCCCeEEEEcchHHHH----------------------------------------------------------
Q 001054 218 LGFISAKTESVVVLLCREPCLN---------------------------------------------------------- 239 (1171)
Q Consensus 218 lg~~~~~~~~~~v~lcr~~c~~---------------------------------------------------------- 239 (1171)
|||||+|+|+|||||||+||+.
T Consensus 80 lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~ 159 (800)
T 2wjy_A 80 LGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENP 159 (800)
T ss_dssp CEEEC-----CCEECCTTTTSSTTC----------CEESBCSSSBCTTTSCCCCHHHHHHSCCCCHHHHHHHHHHHTTCT
T ss_pred eeceecccCceEEEEecCcccccchhhccCCCHHhcccccccccccHhhcCCCCHHHHhhhcCCCHHHHHHHHHHhccCc
Confidence 9999999999999999999976
Q ss_pred ---------------------------------------------HhhhccccccEEEEEEeccCCeEEEEEEccCCCCC
Q 001054 240 ---------------------------------------------MMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNE 274 (1171)
Q Consensus 240 ---------------------------------------------~~ke~~~~~~i~~r~~~~l~~k~~~~~~~~~~~~~ 274 (1171)
.++|++...+++++|++++++|.+++|.++..+.+
T Consensus 160 ~~~~~~~~~~~~~~~~~~v~~~y~~~~~Y~~~~~~l~~lE~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 239 (800)
T 2wjy_A 160 SATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSD 239 (800)
T ss_dssp TCCTTC--------CCCCCCSCCSCHHHHHHHHHHHHHHHHHHHHHHHHHTCEEEECCEEEECTTCCEEEEECCCBCCC-
T ss_pred CcchhhhhhccccccccccccccCCHHHHHHHHHHHHHHHHHhhhhhhhhhhccceEEEEEecCCCeeEEEEEeccccCC
Confidence 34566777899999999999999999999887778
Q ss_pred CCCCCCCEEEEEecCCCCCCcceEEEEEEEecc--ccEEEEEeccCCCCCcccCCCceEEEecccchHHHHHHHHHHHHH
Q 001054 275 LRLVPGDELRLRYSGDAAHPAWQSVGHVIKLTA--QEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAV 352 (1171)
Q Consensus 275 ~~l~~GD~v~l~~~g~~~~~~~~~~G~V~ki~~--~~~v~l~l~~~~~~p~~~~~~~~v~~~~~~~s~~Rm~~AL~~~~~ 352 (1171)
.+|.+||+|.|++.+. ....|...|+|+++.+ .++|.|++......|.+....|.++++|++++|+||+.||++++.
T Consensus 240 ~~l~~GD~v~l~~~~~-~~~~~~~~g~V~~v~~~~~~~v~l~~~~~~~~p~~~~~~~~v~~~~~~~~~~r~~~aL~~~~~ 318 (800)
T 2wjy_A 240 MRLMQGDEICLRYKGD-LAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAV 318 (800)
T ss_dssp -CCCTTCEEEEEECSS-SSCCEEEEEEEEECSBTTBSCEEEEESCCTTCCTTCCSCEEEEECCCCHHHHHHHHHHHHHHH
T ss_pred CCCCCCCEEEEEECCC-CCCCceeEEEEEEEcCCCCCEEEEEEccCCCCccccCCCceEEEeecCChHHHHHHHHHHHHH
Confidence 8999999999998776 4567899999999986 468999987666677777778999999999999999999999999
Q ss_pred hhhhhhhhHHhhhcCCchhhhhhhccCCcccCCCCCCCCCHHHHHHHHHhhcCCcEEEEcCCCChHhHHHHHHHHHHHHc
Q 001054 353 DETSVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKTVTSAAIVYHMAKQ 432 (1171)
Q Consensus 353 ~e~~vs~~I~~~llg~~~~~~~~~~~lp~~f~~p~l~~LNesQ~~AV~~aL~~~lsLIqGPPGTGKTtTla~iI~~Llk~ 432 (1171)
++..++.+|++.++++...+..++..+|+.|..+.+..||++|++||..++..++++|+||||||||+|+++++.+|++.
T Consensus 319 ~e~~~~~~l~~~ll~~~~~~~~~~~~l~~~~~~~~~~~Ln~~Q~~Av~~~l~~~~~lI~GppGTGKT~ti~~~i~~l~~~ 398 (800)
T 2wjy_A 319 DETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQ 398 (800)
T ss_dssp CTTSBCHHHHHHHTTCCCCCCCCCCCCCSCCSCTTSCCCCHHHHHHHHHHHTSSEEEEECCTTSCHHHHHHHHHHHHHTT
T ss_pred hhcchhHHHHHHhcCCCCCchhhcccCccccccccccCCCHHHHHHHHHhccCCeEEEEcCCCCCHHHHHHHHHHHHHHc
Confidence 99889999999898876555555556677676666788999999999999999999999999999999999999999875
Q ss_pred CCCcEEEEcCcHHHHHHHHHHHHhcCCeEEEeccccccccCCcchhhhHHHHHhhccchhHHHHHHHHhhhhhhccCCch
Q 001054 433 GQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRHLDTSEKSELHKLQQLKDEQGELSSS 512 (1171)
Q Consensus 433 ~~~rILV~ApSN~AVD~L~eRL~~~glkVVRlg~~sre~i~~~v~~l~L~~~i~~l~~~~~~~L~kL~~lk~e~~els~~ 512 (1171)
...+||+|||||+|||+|.+||.+.+++++|+++.+++.+..++..+++|..++.... ...++++.+++.+.+.+...
T Consensus 399 ~~~~ilv~a~tn~A~~~l~~~l~~~g~~vvRlg~~~r~~i~~~~~~~tlh~~~~~~~~--~~~l~~l~~~~~~~~~~~~~ 476 (800)
T 2wjy_A 399 GNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDS--MPELQKLQQLKDETGELSSA 476 (800)
T ss_dssp CSSCEEEEESSHHHHHHHHHHHHTTTCCEEECCCGGGGGCCCTTGGGBHHHHHHTCTT--CHHHHHHHHHHTTTSCCCHH
T ss_pred CCCcEEEEcCcHHHHHHHHHHHHHhCcceEeecccchhhhcchhhhhhHHHHHHcCcc--HHHHHHHHHHHHhhcccChH
Confidence 5669999999999999999999999999999999998888888888999998886654 45667777777777777777
Q ss_pred HHHHHHHHHHHHHHHHHhccccccccccccCCCCcccCCCCEEEEEcCCCCCcccccccccccCceEEEeCCccCCCcee
Q 001054 513 DEKKYKALKRATEREISQSADVICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVI 592 (1171)
Q Consensus 513 dek~y~~l~r~~e~~iL~~a~VI~~T~~~a~~~~L~~~kFD~VIIDEASQasEpe~LIpL~~~~kkLILVGD~~QLpPvv 592 (1171)
+++.|+.+.+..++.+++.++||++||.+++...+...+||+||||||+|++++++|+++...++++|||||++||+|++
T Consensus 477 ~~~~~~~~~~~~~~~~l~~a~VI~~T~~~~~~~~l~~~~fd~viIDEAsQ~~e~~~li~l~~~~~~~ilvGD~~QLpPvv 556 (800)
T 2wjy_A 477 DEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVV 556 (800)
T ss_dssp HHHHHHHHHHHHHHHHHHHCSEEEEETGGGGCTTTTTCCCSEEEETTGGGSCHHHHHHHHTTTBSEEEEEECTTSCCCCC
T ss_pred HHHHHHHHHHHHHHhhhccCCEEEEchhhhCChhhhcCCCCEEEEECCCCCCcHHHHHHHHhcCCeEEEecccccCCCee
Confidence 77888888888888999999999999999988888888999999999999999999999988889999999999999999
Q ss_pred ecHHHHhhcchHHHHHHHHHcCCccEEeeeeccCCCCCCcccccccccCcccccccccccccCCCCCCCCCCCCCeEEEE
Q 001054 593 MCKKAARAGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDFPWPVPNRPMFFYV 672 (1171)
Q Consensus 593 ~s~~a~~~gl~~SLFERL~~~g~~~i~L~~qYRmhp~I~~f~S~lFY~g~L~~~~~~~~r~l~~~~~~~p~~~~Pvif~~ 672 (1171)
.+..+...++..|+|+||...+..+++|++|||||++|++|+|.+||+|+|.++.....+......++|+....|++|+.
T Consensus 557 ~s~~a~~~gl~~SlFerL~~~g~~~~~L~~qYRm~p~I~~f~n~~fY~g~L~~~~~~~~r~~~~~~~~~~~~~~p~~f~~ 636 (800)
T 2wjy_A 557 MCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYV 636 (800)
T ss_dssp CCHHHHHTTTTSCHHHHHHHTTCCCEECCEECSSCHHHHHHHHHHHSTTCCEESSCSGGGSCTTCCCCCSSTTSCEEEEE
T ss_pred cchhhhhcCcchHHHHHHHhCCCCceEehhhcCCCcHHHHhhHHHhcCCccccCCchhhhccccccccccCCCCCEEEEE
Confidence 99888888999999999998888889999999999999999999999999998877766666666778888889999999
Q ss_pred cCCceeecccCCcccCHHHHHHHHHHHHHHHHcCCCCCcEEEEecchhHHHHHHHHHHhccchhhhcCCCeEEecccCcc
Q 001054 673 QMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYEGQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQ 752 (1171)
Q Consensus 673 ~~G~ee~~~~g~S~~N~~EA~~V~~iV~~Llk~Gv~~~dIGIITPY~aQv~~I~~~L~~~g~l~~~~~~~V~V~TVdsfQ 752 (1171)
+.|.++....+.|+.|..||+.|.+++..|++.|+++++|||||||++|+..|++.|.+.+.+.......|+|.|||+||
T Consensus 637 ~~g~e~~~~~~~S~~N~~Ea~~V~~~v~~L~~~g~~~~dIgVItPy~~Q~~~I~~~L~~~~~~~~~~~~~v~V~TVd~fQ 716 (800)
T 2wjy_A 637 TQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQ 716 (800)
T ss_dssp CCCCCEECSSBSCEECHHHHHHHHHHHHHHHHTTCCGGGEEEECSCHHHHHHHHHHHHHHCSSCHHHHHTSEEECGGGGT
T ss_pred cCCceeecCCCCcccCHHHHHHHHHHHHHHHHcCCCcccEEEEeccHHHHHHHHHHHHhcCcccccccCceEEccccccC
Confidence 99988877788999999999999999999999999999999999999999999999987654443344679999999999
Q ss_pred cCccCeEEEeccccCCcCCcCCCCCcCceeeechhhccceEEEecccccccCchHHHHHHHHHhcCceecCCCcchhhhh
Q 001054 753 GREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSM 832 (1171)
Q Consensus 753 G~E~DvVILS~VRSn~~~~iGFL~D~RRLNVALTRAK~~LIIVGn~~~Ls~~~~W~~Ll~~~ke~~~lv~g~l~~l~~s~ 832 (1171)
|+|+|+||||+||++...++||+.|+|||||||||||++|+||||..+|+++++|++|++|++++++++++++.+|++++
T Consensus 717 G~E~dvVIlS~vrs~~~~~~gfl~d~rrLNVAlTRAk~~LiIvG~~~~l~~~~~w~~ll~~~~~~~~~~~~~~~~l~~~~ 796 (800)
T 2wjy_A 717 GREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVEGPLNNLRESL 796 (800)
T ss_dssp TCCEEEEEEECCCCSCCCCCGGGTCHHHHHHHHTSEEEEEEEEECHHHHTSSHHHHHHHHHHHHTTCEEESCGGGCEECC
T ss_pred CCcCCEEEEEecCCCCccccccccCcchhhhhHHhhhccEEEEECHHHhccCHHHHHHHHHHHHCCCEEeCCHHHhhhhc
Confidence 99999999999999988889999999999999999999999999999999999999999999999999999999999999
Q ss_pred hccc
Q 001054 833 VQFQ 836 (1171)
Q Consensus 833 ~~~~ 836 (1171)
++++
T Consensus 797 ~~~~ 800 (800)
T 2wjy_A 797 MQFS 800 (800)
T ss_dssp CCC-
T ss_pred ccCC
Confidence 8763
|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* | Back alignment and structure |
|---|
| >3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, STR genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >1w36_C RECC, exodeoxyribonuclease V gamma chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.25 PDB: 3k70_C* | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
| >1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1171 | ||||
| d1w36d1 | 359 | c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha c | 2e-19 | |
| d1svma_ | 362 | c.37.1.20 (A:) Papillomavirus large T antigen heli | 1e-06 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 1e-05 | |
| d1uaaa1 | 306 | c.37.1.19 (A:2-307) DEXX box DNA helicase {Escheri | 4e-05 | |
| g1qhh.1 | 623 | c.37.1.19 (A:,B:,C:,D:) DEXX box DNA helicase {Bac | 1e-04 | |
| d1pjra1 | 318 | c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillu | 2e-04 | |
| d1a1va1 | 136 | c.37.1.14 (A:190-325) HCV helicase domain {Human h | 5e-04 | |
| d2i3ba1 | 189 | c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 | 8e-04 | |
| d1w36d2 | 246 | c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha | 0.002 |
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Length = 359 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Exodeoxyribonuclease V alpha chain (RecD) species: Escherichia coli [TaxId: 562]
Score = 89.2 bits (220), Expect = 2e-19
Identities = 46/250 (18%), Positives = 83/250 (33%), Gaps = 59/250 (23%)
Query: 347 MKTFAVDETSVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRP 406
+ +E +V+ + EV+ ++ TL + F + Q A L R
Sbjct: 108 LNRMWCNERTVARFFNEVNHAIEVDEALLAQTLDKLFPVS---DEINWQKVAAAVALTRR 164
Query: 407 ISLIQGPPGTGKTVTSAAIVYHMAKQGQGQ---VLVCAPSNVAVDQLAEKISATGLKVVR 463
IS+I G PGTGKT T A ++ + + G+ + + AP+ A +L E G + +
Sbjct: 165 ISVISGGPGTGKTTTVAKLLAALIQMADGERCRIRLAAPTGKAAARLTES---LGKALRQ 221
Query: 464 LCAKSREAVSSPVEHLTLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRA 523
L + P + TLH + S++ H
Sbjct: 222 LPLTDEQKKRIPEDASTLHRLLGAQPGSQRLRHHAGN----------------------- 258
Query: 524 TEREISQSADVICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPL--VLGAKQVVL 581
+++DE++ P + + +V+
Sbjct: 259 -------------------------PLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIF 293
Query: 582 VGDHCQLGPV 591
+GD QL V
Sbjct: 294 LGDRDQLASV 303
|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Length = 306 | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Length = 318 | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 | Back information, alignment and structure |
|---|
| >d1w36d2 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Length = 246 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1171 | |||
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.94 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 99.87 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 99.83 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.79 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 99.52 | |
| d1w36b2 | 395 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 99.0 | |
| d1pjra2 | 333 | DEXX box DNA helicase {Bacillus stearothermophilus | 98.92 | |
| d1uaaa2 | 333 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 98.87 | |
| d1w36d2 | 246 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 98.65 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 98.6 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 98.53 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 98.46 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 98.36 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 98.26 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 98.13 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 98.11 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 98.1 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 97.98 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 97.94 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 97.93 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 97.9 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 97.86 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 97.85 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 97.81 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 97.79 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 97.74 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 97.71 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 97.59 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 97.48 | |
| d1w36c2 | 470 | Exodeoxyribonuclease V gamma chain (RecC), N-termi | 97.38 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 96.98 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.82 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.79 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 96.71 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.55 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 96.54 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 96.47 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.4 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 96.36 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 95.95 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 95.82 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 95.77 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 95.67 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 95.44 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 95.22 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 95.16 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 95.14 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.13 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 95.1 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 95.09 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 95.09 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.07 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 95.07 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 94.97 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 94.93 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 94.89 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 94.72 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 94.66 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 94.56 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 94.47 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 94.44 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 94.26 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 94.21 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.98 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 93.98 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 93.82 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 93.72 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 93.66 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 93.64 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 93.61 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 93.51 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 93.25 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 93.25 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 93.16 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 93.1 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 93.09 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 93.01 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 92.95 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 92.85 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 92.75 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 92.55 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 92.54 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.54 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 92.45 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 92.37 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 92.36 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 92.28 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 92.27 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 92.17 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 92.07 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 92.04 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 91.98 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 91.91 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 91.89 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 91.87 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 91.82 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 91.78 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 91.44 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 91.39 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 91.27 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 91.24 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 91.12 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 91.09 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 90.86 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 90.81 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 90.77 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 90.77 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 90.69 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 90.68 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 90.46 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 90.4 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 90.34 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 90.32 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 90.26 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 90.21 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 90.11 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 89.63 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 89.4 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 89.4 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 89.23 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 88.93 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 88.8 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 88.74 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 88.39 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 87.84 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 87.8 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 87.76 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 87.21 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 87.04 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 86.67 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 86.44 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 86.33 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 85.76 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 85.49 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 85.35 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 85.34 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 85.05 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 84.62 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 84.34 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 83.72 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 83.47 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 82.0 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 81.94 |
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1uaaa2 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36d2 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1w36c2 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|