Citrus Sinensis ID: 001070


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160-----
MSSQSQSQSPNQNQKQFDMRNWFPPYPPPSSSAAGDNFFPYPPPPPPPPPEPHANMHPHPYPHGPHRLLPYTPLPTTTVVSPNAGPQILALLNNNKSKHVGSTAPIYGKRVFGDYVAYDVDAVEEGREPTQQLEVNPITKYGSDPELLIGRQIAVNKHYVCYGLKGGNVRVLNLNTATRSLLRGHTKIKIWEDSKVAPLIILKPHGGQPVNSAQYLTAPNQAGHIILVTAGPLNREVKLWASASEEGWSLPTHAESWKCTQTLDLKSSAKPRVEEAFFNQVVVLSQAGLLLFANAKKNAIYSVHLGYGNNSAATRIDYIAEFTVTMPVLSFTGTIDPPSEHIIKLYCVQTQAIQQYSLNLFQCLPPPAESGGLERPDSSVSNDANGSRLSEFLFPSSTSKPSFSETTGAVRYPQLSTSHEATTSQENLTSKTESQPLSLARTTSDTNVVCVASPPLPLSPSFSRKHSGSINPPNSSELGSLLNEPGGSQPIIDSSFDGKTDTTQVLSHVPSLDSDANNDKINIAPNDISRALNPSMFKHPTHLITPSEILMSASSSETTNIIGGKNEEEVVVNSDAGNAEVEVKVLDETRFTHDEFGSRGESQNLVSENREKYLRYQATDPRIGMAAKCAGTSAETCVAEEAQEVDGAGIMETLAQPPCNDEAEVEDSTQDLDGGVSDSTMTTTFAQTGASSAKGKKQKEKKYQASSQCSPSSTVLNLANLSNEPAGSSSLPSAPAAFSQVIAMQDMLNQLMTMQKELQKQMSNLVTLPVTKEGRRLEASLGRGIEKAVKASTDALWARFHEENARNEKLLRDRTQQITGLITNLINKDLTASLEKLVKKELAAVGPAIVRTISPSIEKTITSAIVESFQRGVGDKAVNQLERSVNSRLEATVGRQIQAQFQTSGKHALQDALKSSVEASVIPAFEKSCKAMFEQVDATFQKGMVEHTTATLQHFESTHSPLALVLRESVNSVSSMAQTLSGEFVDGQRKLFDLAGVRNNTSAFNPSVPLSNGPLLGLHEKVEATMDPTKELSRLVSDRKYEEAFTTALQRSDVSIVSWLCSQVDMHGLLSMVPLPLSQGVLLSLLQQLACDINKDTARKLAWLTDVAAAINPADPMIAVHARPIFEQVYQRLHHQRSSPTISGAELSSIRLLIHVINSMLMTFK
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccEEEEEccccccccccccccEEEEEEcECcccccECccEEEEcccEEEEECccccEEEEEEcccccccccccEEEEEECccccccCEEEcccccccccEEEEcccccccccEEEEEccccccEEEEEEccccccccccccccccEEEEEEEEccccccccHHHcccEEEEcccccEEEEEEccccEEEEEEEEcccccccccccccEEcccccccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccHHHcccccccccccHHHHccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcc
********************************************************************LPYTPLPTTT***************************IYGKRVFGDYVAYDVDAVE********LEVNPITKYGSDPELLIGRQIAVNKHYVCYGLKGGNVRVLNLNTATRSLLRGHTKIKIWEDSKVAPLIILKPHGGQPVNSAQYLTAPNQAGHIILVTAGPLNREVKLWASASEEGWSLPTHAESWKCTQTLDLKSSAKPRVEEAFFNQVVVLSQAGLLLFANAKKNAIYSVHLGYGNNSAATRIDYIAEFTVTMPVLSFTGTIDPPSEHIIKLYCVQTQAIQQYSLNLFQCL****************************************************************************************************************************************************************************************************************************V******************************************************************************************************************************************************************************************************GIEKAVKASTDALWARFHEENARNEKLLRDRTQQITGLITNLINKDLTASLEKLVKKELAAVGPAIVRTISPSIEKTITSAIVESFQRGVGDK******************************************ASVIPAFEKSCKAMFEQVDATFQKGMVEHTTATLQHFESTHSPLALVLRES**********LSGEFVDGQRKLFDLAGVRN****************************************KYEEAFTTALQRSDVSIVSWLCSQVDMHGLLSMVPLPLSQGVLLSLLQQLACDINKDTARKLAWLTDVAAAINPADPMIAVHARPIFEQVYQRLH********SGAELSSIRLLIHVINSMLMTF*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSQSQSQSPNQNQKQFDMRNWFPPYPPPSSSAAGDNFFPYPPPPPPPPPEPHANMHPHPYPHGPHRLLPYTPLPTTTVVSPNAGPQILALLNNNKSKHVGSTAPIYGKRVFGDYVAYDVDAVEEGREPTQQLEVNPITKYGSDPELLIGRQIAVNKHYVCYGLKGGNVRVLNLNTATRSLLRGHTKIKIWEDSKVAPLIILKPHGGQPVNSAQYLTAPNQAGHIILVTAGPLNREVKLWASASEEGWSLPTHAESWKCTQTLDLKSSAKPRVEEAFFNQVVVLSQAGLLLFANAKKNAIYSVHLGYGNNSAATRIDYIAEFTVTMPVLSFTGTIDPPSEHIIKLYCVQTQAIQQYSLNLFQCLPPPAESGGLERPDSSVSNDANGSRLSEFLFPSSTSKPSFSETTGAVRYPQLSTSHEATTSQENLTSKTESQPLSLARTTSDTNVVCVASPPLPLSPSFSRKHSGSINPPNSSELGSLLNEPGGSQPIIDSSFDGKTDTTQVLSHVPSLDSDANNDKINIAPNDISRALNPSMFKHPTHLITPSEILMSASSSETTNIIGGKNEEEVVVNSDAGNAEVEVKVLDETRFTHDEFGSRGESQNLVSENREKYLRYQATDPRIGMAAKCAGTSAETCVAEEAQEVDGAGIMETLAQPPCNDEAEVEDSTQDLDGGVSDSTMTTTFAQTGASSAKGKKQKEKKYQASSQCSPSSTVLNLANLSNEPAGSSSLPSAPAAFSQVIAxxxxxxxxxxxxxxxxxxxxxLVTLPVTKEGRRLEASLGRGIEKAVKASTDALWARFHEENARNEKLLRDRTQQITGLITNLINKDLTASLEKLVKKELAAVGPAIVRTISPSIEKTITSAIVESFQRGVGDKAVNQLERSVNSRLEATVGRQIQAQFQTSGKHALQDALKSSVEASVIPAFEKSCKAMFEQVDATFQKGMVEHTTATLQHFESTHSPLALVLRESVNSVSSMAQTLSGEFVDGQRKLFDLAGVRNNTSAFNPSVPLSNGPLLGLHEKVEATMDPTKELSRLVSDRKYEEAFTTALQRSDVSIVSWLCSQVDMHGLLSMVPLPLSQGVLLSLLQQLACDINKDTARKLAWLTDVAAAINPADPMIAVHARPIFEQVYQRLHHQRSSPTISGAELSSIRLLIHVINSMLMTFK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Enhancer of mRNA-decapping protein 4 As a component of the decapping complex, involved in the degradation of mRNAs. Essential for postembryonic development, especially during the formation of the shoot (SAM) and root apical meristems. Required for normal patterning of internal tissues of leaves.probableQ9LTT8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VXG, chain A
Confidence level:very confident
Coverage over the Query: 1027-1161
View the alignment between query and template
View the model in PyMOL
Template: 1ERJ, chain A
Confidence level:confident
Coverage over the Query: 153-245,258-348
View the alignment between query and template
View the model in PyMOL
Template: 3GRE, chain A
Confidence level:confident
Coverage over the Query: 107-245,258-308
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 50-62
View the alignment between query and template
View the model in PyMOL
Template: 3S84, chain A
Confidence level:probable
Coverage over the Query: 783-816
View the alignment between query and template
View the model in PyMOL