Citrus Sinensis ID: 001070

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160-----

MSSQSQSQSPNQNQKQFDMRNWFPPYPPPSSSAAGDNFFPYPPPPPPPPPEPHANMHPHPYPHGPHRLLPYTPLPTTTVVSPNAGPQILALLNNNKSKHVGSTAPIYGKRVFGDYVAYDVDAVEEGREPTQQLEVNPITKYGSDPELLIGRQIAVNKHYVCYGLKGGNVRVLNLNTATRSLLRGHTKIKIWEDSKVAPLIILKPHGGQPVNSAQYLTAPNQAGHIILVTAGPLNREVKLWASASEEGWSLPTHAESWKCTQTLDLKSSAKPRVEEAFFNQVVVLSQAGLLLFANAKKNAIYSVHLGYGNNSAATRIDYIAEFTVTMPVLSFTGTIDPPSEHIIKLYCVQTQAIQQYSLNLFQCLPPPAESGGLERPDSSVSNDANGSRLSEFLFPSSTSKPSFSETTGAVRYPQLSTSHEATTSQENLTSKTESQPLSLARTTSDTNVVCVASPPLPLSPSFSRKHSGSINPPNSSELGSLLNEPGGSQPIIDSSFDGKTDTTQVLSHVPSLDSDANNDKINIAPNDISRALNPSMFKHPTHLITPSEILMSASSSETTNIIGGKNEEEVVVNSDAGNAEVEVKVLDETRFTHDEFGSRGESQNLVSENREKYLRYQATDPRIGMAAKCAGTSAETCVAEEAQEVDGAGIMETLAQPPCNDEAEVEDSTQDLDGGVSDSTMTTTFAQTGASSAKGKKQKEKKYQASSQCSPSSTVLNLANLSNEPAGSSSLPSAPAAFSQVIAMQDMLNQLMTMQKELQKQMSNLVTLPVTKEGRRLEASLGRGIEKAVKASTDALWARFHEENARNEKLLRDRTQQITGLITNLINKDLTASLEKLVKKELAAVGPAIVRTISPSIEKTITSAIVESFQRGVGDKAVNQLERSVNSRLEATVGRQIQAQFQTSGKHALQDALKSSVEASVIPAFEKSCKAMFEQVDATFQKGMVEHTTATLQHFESTHSPLALVLRESVNSVSSMAQTLSGEFVDGQRKLFDLAGVRNNTSAFNPSVPLSNGPLLGLHEKVEATMDPTKELSRLVSDRKYEEAFTTALQRSDVSIVSWLCSQVDMHGLLSMVPLPLSQGVLLSLLQQLACDINKDTARKLAWLTDVAAAINPADPMIAVHARPIFEQVYQRLHHQRSSPTISGAELSSIRLLIHVINSMLMTFK

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccEEEEEccccccccccccccEEEEEEcEEcccccEEccEEEEcccEEEEEEccccEEEEEEcccccccccccEEEEEEEccccccEEEEcccccccccEEEEcccccccccEEEEEccccccEEEEEEccccccccccccccccEEEEEEEEccccccccHHHcccEEEEcccccEEEEEEccccEEEEEEEEcccccccccccccEEcccccccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccHHcHHHcccccccccccHHHHHcccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcc

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccEccccEEEEEccccccccccccccEEcEEEEEccccccEccEEEEEccEEEEEEcccccEEEEEHHHHHHHHHccccEEEEEccccccccEEEcccccccEEEEEEEccccccccEEEEEccccccEEEEEEEcccccccccccccccEEEEEEEEccccccccHHHHHHHHHHcHHHcEEEEEcccccEEEEEEEEcccccccccHHHHEHEEEEccEEEEccccccccccEEEEEEEHHHHHHHHccccHcccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccHccccccccccccccccccccccEEEEEEEcccccccHHccccccccccccHHHHccccccccccccHHHHccccccccccccccccccccccccHHccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHccccHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHcccHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcc

mssqsqsqspnqnqkqfdmrnwfppypppsssaagdnffpypppppppppephanmhphpyphgphrllpytplptttvvspnagpQILALLNnnkskhvgstapiygkrvfgdyvaydvdaveegreptqqlevnpitkygsdpelligrQIAVNKHYVCYglkggnvrVLNLNTATRSLLRGHTkikiwedskvapliilkphggqpvnsaqyltapnqagHIILVTAGPLNREVKLWASAseegwslpthaeswkctqtldlkssakprVEEAFFNQVVVLSQAGLLLFANAKKNAIYSVHlgygnnsaaTRIDYIAEFTvtmpvlsftgtidppseHIIKLYCVQTQAIQQYSLNlfqclpppaesgglerpdssvsndangsrlseflfpsstskpsfsettgavrypqlstsheattsqenltsktesqplslarttsdtnvvcvaspplplspsfsrkhsgsinppnsselgsllnepggsqpiidssfdgktdttqvlshvpsldsdanndkiniapndisralnpsmfkhpthlitpseilmsasssettniiggkneeEVVVNSDAGNAEVEVKVLDetrfthdefgsrgesqnlvSENREKYLRyqatdprigmaakcagtsaetcVAEEaqevdgagimetlaqppcndeaevedstqdldggvsdstmTTTFaqtgassakgkkqkekkyqassqcspsstvlnlanlsnepagssslpsapaAFSQVIAMQDMLNQLMTMQKELQKQMSNlvtlpvtkegRRLEASLGRGIEKAVKASTDALWARFHEENARNEKLLRDRTQQITGLITNLINKDLTASLEKLVKKELAAVGPAIVRTISPSIEKTITSAIVESFqrgvgdkaVNQLERSVNSRLEATVGRQIQAQFQTSGKHALQDALKSSVEASVIPAFEKSCKAMFEQVDATFQKGMVEHTTATLQHFESTHSPLALVLRESVNSVSSMAQTLSGEFVDGQRKLFDLagvrnntsafnpsvplsngpllglhekveatmdptKELSRLVSDRKYEEAFTTALQRSDVSIVSWLCSQVdmhgllsmvplplsQGVLLSLLQQLACDINKDTARKLAWLTDVAaainpadpmiavhaRPIFEQVYQRLhhqrssptisgaeLSSIRLLIHVINSMLMTFK

mssqsqsqspnqnqKQFDMRNWFPPYPPPSSSAAGDNFFPYPPPPPPPPPEPHANMHPHPYPHGPHRLLPYTPLPTTTVVSPNAGPQILALLNnnkskhvgstapiygkrvFGDYVAYDVDAVeegreptqqlevnpitkygsdpELLIGRQIAVNKHYVCYGLKGGNVRVLNLNTATRSLLRGHTKIKIWEDSKVAPLIILKPHGGQPVNSAQYLTAPNQAGHIILVTAGPLNREVKLWASASEEGWSLPTHAESWKCTQTLDLKSSAKPRVEEAFFNQVVVLSQAGLLLFANAKKNAIYSVHLGYGNNSAATRIDYIAEFTVTMPVLSFTGTIDPPSEHIIKLYCVQTQAIQQYSLNLFQCLPPPAESGGLERPDSSVSNDANGSRLSEFlfpsstskpsfsetTGAVRYPQLSTsheattsqenltsktesqplslarttsdtnVVCVASPPLPLSPSFSRKHSGSINPPNSSELGSLLNEPGGSQPIIDSSFDGKTDTTQVLShvpsldsdanndKINIAPNDISRALNPSMFKHPTHLITPSEILMSASSSETTNIIGGKNEEEVVVNSDAGNAEVEVKVLDEtrfthdefgsrgesqnlvsenREKYLRYQATDPRIGMAAKCAGTSAETCVAEEAQEVDGAGIMETLAQPPCNDEAEVEDSTQDLDGGVSDSTMTTTFaqtgassakgkkqkekkyqassqcspssTVLNLANLSNEPAGSSSLPSAPAAFSQVIAMQDMLNQLMTMQKELQKQMSNLVTLPVTKEGRRLEASLGRGIEKAVKASTDALWARFHEenarnekllrdRTQQITGLITNLINKDLTASLEKLVKKELaavgpaivrtispsiekTITSAIVESFQRGVGDKAVNQLERSVNSRLEATVGRQIQAQFQTSGKHALQDALKSSVEASVIPAFEKSCKAMFEQVDATFQKGMVEHTTATLQHFESTHSPLALVLRESVNSVSSMAQTLSGEFVDGQRKLFDLAGVRNNTsafnpsvplsngPLLGLHEKVEATMDPTKELSRLVSDRKYEEAFTtalqrsdvsIVSWLCSQVDMHGLLSMVPLPLSQGVLLSLLQQLACDINKDTARKLAWLTDVAAAINPADPMIAVHARPIFEQVYQRLHHQrssptisgaelsSIRLLIHVINSMLMTFK

MssqsqsqspnqnqKQFDMRNWFppypppsssAAGDNFFpypppppppppephanmhphpYPHGPHRllpytplptttVVSPNAGPQILALLNNNKSKHVGSTAPIYGKRVFGDYVAYDVDAVEEGREPTQQLEVNPITKYGSDPELLIGRQIAVNKHYVCYGLKGGNVRVLNLNTATRSLLRGHTKIKIWEDSKVAPLIILKPHGGQPVNSAQYLTAPNQAGHIILVTAGPLNREVKLWASASEEGWSLPTHAESWKCTQTLDLKSSAKPRVEEAFFNQVVVLSQAGLLLFANAKKNAIYSVHLGYGNNSAATRIDYIAEFTVTMPVLSFTGTIDPPSEHIIKLYCVQTQAIQQYSLNLFQCLPPPAESGGLERPDSSVSNDANGSRLSEFLFPSSTSKPSFSETTGAVRYPQLSTSHEATTSQENLTSKTESQPLSLARTTSDTNVVCVAspplplspsfsRKHSGSINPPNSSELGSLLNEPGGSQPIIDSSFDGKTDTTQVLSHVPSLDSDANNDKINIAPNDISRALNPSMFKHPTHLITPSEILMSASSSETTNIIGGKNEEEVVVNSDAGNAEVEVKVLDETRFTHDEFGSRGESQNLVSENREKYLRYQATDPRIGMAAKCAGTSAETCVAEEAQEVDGAGIMETLAQPPCNDEAEVEDSTQDLDGGVSDSTMTTTFAQTGassakgkkqkekkyqassqCSPSSTVLNLANLSNEpagssslpsapaaFSQVIAMQDMLNQLMTMQKELQKQMSNLVTLPVTKEGRRLEASLGRGIEKAVKASTDALWARFHEENARNEKLLRDRTQQITGLITNLINKDLTASLEKLVKKELAAVGPAIVRTISPSIEKTITSAIVESFQRGVGDKAVNQLERSVNSRLEATVGRQIQAQFQTSGKHALQDALKSSVEASVIPAFEKSCKAMFEQVDATFQKGMVEHTTATLQHFESTHSPLALVLRESVNSVSSMAQTLSGEFVDGQRKLFDLAGVRNNTSAFNPSVPLSNGPLLGLHEKVEATMDPTKELSRLVSDRKYEEAFTTALQRSDVSIVSWLCSQVDMHGLLSMvplplsqgvllsllqqlACDINKDTARKLAWLTDVAAAINPADPMIAVHARPIFEQVYQRLHHQRSSPTISGAELSSIRLLIHVINSMLMTFK

********************************************************************LPYTPLPTTTVVSPNAGPQILALLNNNKSKHVGSTAPIYGKRVFGDYVAYDVDAVE********LEVNPITKYGSDPELLIGRQIAVNKHYVCYGLKGGNVRVLNLNTATRSLLRGHTKIKIWEDSKVAPLIILKPHGGQPVNSAQYLTAPNQAGHIILVTAGPLNREVKLWASASEEGWSLPTHAESWKCTQTLDLKSSAKPRVEEAFFNQVVVLSQAGLLLFANAKKNAIYSVHLGYGNNSAATRIDYIAEFTVTMPVLSFTGTIDPPSEHIIKLYCVQTQAIQQYSLNLFQCL****************************************************************************************************************************************************************************************************************************V***************************YLRYQATDPRIGMAAKCAGTSAETCV*************************************************************************************************************************************************GIEKAVKASTDALWARFHEENARNEKLLRDRTQQITGLITNLINKDLTASLEKLVKKELAAVGPAIVRTISPSIEKTITSAIVESFQRGVGDK******************************************ASVIPAFEKSCKAMFEQVDATFQKGMVEHTTATLQHFESTHSPLALVLRES**********LSGEFVDGQRKLFDLAGVRN****************************************KYEEAFTTALQRSDVSIVSWLCSQVDMHGLLSMVPLPLSQGVLLSLLQQLACDINKDTARKLAWLTDVAAAINPADPMIAVHARPIFEQVYQRLHHQ*****ISGAELSSIRLLIHVINSMLM***

**************************************************************************************************************VFGDYVA*******************PITKYGSDPELLIGRQIAVNKHYVCYGLKGGNVRVLNLNTATRSLLRGHTKIKIWEDSKVAPLIILKPHGGQPVNSAQYLTAPNQAGHIILVTAGPLNREVKLWASASEEGWSLPTHAESWKCTQTLDLKS*A******AFFNQVVVLSQAGLLLFANAKKNAIYSVHLGYGNNSAATRIDYIAEFTVTMPVLSFTGTIDPPSEHIIKLYCVQTQAIQQYSLN*************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************F*TALQRSDVSIVSWLCSQVDMHGLLSMVPLPLSQGVLLSLLQQLACDINKDTARKLAWLTDVAAAINPADPMIAVHARPIFEQVYQRLH****************RLLIHVINSMLMTF*

***************QFDMRNWFPPYPPPSSSAAGDNFFPYPPPPPPPPPEPHANMHPHPYPHGPHRLLPYTPLPTTTVVSPNAGPQILALLNNNKSKHVGSTAPIYGKRVFGDYVAYDVDAVEEGREPTQQLEVNPITKYGSDPELLIGRQIAVNKHYVCYGLKGGNVRVLNLNTATRSLLRGHTKIKIWEDSKVAPLIILKPHGGQPVNSAQYLTAPNQAGHIILVTAGPLNREVKLWASASEEGWSLPTHAESWKCTQTLDLKSSAKPRVEEAFFNQVVVLSQAGLLLFANAKKNAIYSVHLGYGNNSAATRIDYIAEFTVTMPVLSFTGTIDPPSEHIIKLYCVQTQAIQQYSLNLFQCLPPPA*****************GSRLSEFLFPS***********GAVRYPQLS***************************SDTNVVCVASPPLPLSPS***********PNSSELGSLLNEPGGSQPIIDSSFDGKTDTTQVLSHVPSLDSDANNDKINIAPNDISRALNPSMFKHPTHLITPSEILMSASSSETTNIIGGKNEEEVVVNSDAGNAEVEVKVLDETRFTHDEFGSRGESQNLVSENREKYLRYQATDPRIGMAAKCAGTSAETCVAEEAQEVDGAGIMETLAQPP*************LDGGVSDSTMTTTFA**************************STVLNLANLSN**********APAAFSQVIAMQDMLNQLMTMQKELQKQMSNLVTLPVTKEGRRLEASLGRGIEKAVKASTDALWARFHEENARNEKLLRDRTQQITGLITNLINKDLTASLEKLVKKELAAVGPAIVRTISPSIEKTITSAIVESFQRGVGDKAVNQLERSVNSRLEATVGRQIQA***************SSVEASVIPAFEKSCKAMFEQVDATFQKGMVEHTTATLQHFESTHSPLALVLRESVNSVSSMAQTLSGEFVDGQRKLFDLAGVRNNTSAFNPSVPLSNGPLLGLHEKVEATMDPTKELSRLVSDRKYEEAFTTALQRSDVSIVSWLCSQVDMHGLLSMVPLPLSQGVLLSLLQQLACDINKDTARKLAWLTDVAAAINPADPMIAVHARPIFEQVYQ***********SGAELSSIRLLIHVINSMLMTFK

*************QKQFDMRNWFPPYPPPSSSAAGDNFFPYPPPPPPPPPEPHANMHPHPYPHGPHRLLPYTPLPTTT***************************IYGKRVFGDYVAYDVDAVEEGREPTQQLEVNPITKYGSDPELLIGRQIAVNKHYVCYGLKGGNVRVLNLNTATRSLLRGHTKIKIWEDSKVAPLIILKPHGGQPVNSAQYLTAPNQAGHIILVTAGPLNREVKLWASASEEGWSLPTHAESWKCTQTLDLKSSAKPRVEEAFFNQVVVLSQAGLLLFANAKKNAIYSVHLGYGNNSAATRIDYIAEFTVTMPVLSFTGTIDPPSEHIIKLYCVQTQAIQQYSLNLFQCLPPPA*******************************************************************************************************************************************************************LNPSMFKHPTHLITP*EIL***************************NAEVEVKVLDE**************************************************************************************************************************************************PAAFSQVIAMQDMLNQLMTMQKELQKQMSNLVTLPVTKEGRRLEASLGRGIEKAVKASTDALWARFHEENARNEKLLRDRTQQITGLITNLINKDLTASLEKLVKKELAAVGPAIVRTISPSIEKTITSAIVESFQRGVGDKAVNQLERSVNSRLEATVGRQIQAQFQTSGKHALQDALKSSVEASVIPAFEKSCKAMFEQVDATFQKGMVEHTTATLQHFESTHSPLALVLRESVNSVSSMAQTLSGEFVDGQRKLFDLAGVRN*************************TMDPTKELSRLVSDRKYEEAFTTALQRSDVSIVSWLCSQVDMHGLLSMVPLPLSQGVLLSLLQQLACDINKDTARKLAWLTDVAAAINPADPMIAVHARPIFEQVYQRLHHQRSSPTISGAELSSIRLLIHVINSMLMTFK

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSSQSQSQSPNQNQKQFDMRNWFPPYPPPSSSAAGDNFFPYPPPPPPPPPEPHANMHPHPYPHGPHRLLPYTPLPTTTVVSPNAGPQILALLNNNKSKHVGSTAPIYGKRVFGDYVAYDVDAVEEGREPTQQLEVNPITKYGSDPELLIGRQIAVNKHYVCYGLKGGNVRVLNLNTATRSLLRGHTKIKIWEDSKVAPLIILKPHGGQPVNSAQYLTAPNQAGHIILVTAGPLNREVKLWASASEEGWSLPTHAESWKCTQTLDLKSSAKPRVEEAFFNQVVVLSQAGLLLFANAKKNAIYSVHLGYGNNSAATRIDYIAEFTVTMPVLSFTGTIDPPSEHIIKLYCVQTQAIQQYSLNLFQCLPPPAESGGLERPDSSVSNDANGSRLSEFLFPSSTSKPSFSETTGAVRYPQLSTSHEATTSQENLTSKTESQPLSLARTTSDTNVVCVASPPLPLSPSFSRKHSGSINPPNSSELGSLLNEPGGSQPIIDSSFDGKTDTTQVLSHVPSLDSDANNDKINIAPNDISRALNPSMFKHPTHLITPSEILMSASSSETTNIIGGKNEEEVVVNSDAGNAEVEVKVLDETRFTHDEFGSRGESQNLVSENREKYLRYQATDPRIGMAAKCAGTSAETCVAEEAQEVDGAGIMETLAQPPCNDEAEVEDSTQDLDGGVSDSTMTTTFAQTGASSAKGKKQKEKKYQASSQCSPSSTVLNLANLSNEPAGSSSLPSAPAAFSQVIAxxxxxxxxxxxxxxxxxxxxxLVTLPVTKEGRRLEASLGRGIEKAVKASTDALWARFHEENARNEKLLRDRTQQITGLITNLINKDLTASLEKLVKKELAAVGPAIVRTISPSIEKTITSAIVESFQRGVGDKAVNQLERSVNSRLEATVGRQIQAQFQTSGKHALQDALKSSVEASVIPAFEKSCKAMFEQVDATFQKGMVEHTTATLQHFESTHSPLALVLRESVNSVSSMAQTLSGEFVDGQRKLFDLAGVRNNTSAFNPSVPLSNGPLLGLHEKVEATMDPTKELSRLVSDRKYEEAFTTALQRSDVSIVSWLCSQVDMHGLLSMVPLPLSQGVLLSLLQQLACDINKDTARKLAWLTDVAAAINPADPMIAVHARPIFEQVYQRLHHQRSSPTISGAELSSIRLLIHVINSMLMTFK

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1165	2.2.26 [Sep-21-2011]
Q9LTT8		1344	Enhancer of mRNA-decappin	yes	no	0.808	0.700	0.531	0.0
Q9LTT9		1340	Varicose-related protein	no	no	0.817	0.710	0.492	0.0
Q7ZXT3		1391	Enhancer of mRNA-decappin	N/A	no	0.339	0.284	0.227	3e-19
Q6P2E9		1401	Enhancer of mRNA-decappin	yes	no	0.286	0.238	0.254	1e-18
Q1LUT1		1384	Enhancer of mRNA-decappin	yes	no	0.319	0.268	0.235	3e-18
Q3ZAV8		1407	Enhancer of mRNA-decappin	yes	no	0.296	0.245	0.260	2e-17
Q3UJB9		1406	Enhancer of mRNA-decappin	yes	no	0.296	0.245	0.257	3e-17
Q9VKK1		1354	Enhancer of mRNA-decappin	yes	no	0.317	0.273	0.231	3e-12

>sp\|Q9LTT8\|VCS_ARATH Enhancer of mRNA-decapping protein 4 OS=Arabidopsis thaliana GN=VCS PE=1 SV=1	Back alignment and function desciption

 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/1000 (53%), Positives = 667/1000 (66%), Gaps = 58/1000 (5%)

Query: 188  IKIWEDSKVAPLIILKPHGGQPVNSAQYLTAPNQAGHIILVTAGPLNREVKLWASASEEG 247
            IKIW+D K  PL++L+PH G PV+SA ++T+P +  HIIL+T GPLNRE+K+W SA EEG
Sbjct: 381  IKIWQDRKAQPLVVLRPHDGHPVSSATFVTSPERPDHIILITGGPLNREMKIWVSAGEEG 440

Query: 248  WSLPTHAESWKCTQTLDLKSSAKPRVEEAFFNQVVVLSQAGLLLFANAKKNAIYSVHLGY 307
            W LP  AESW+CTQTLDLKSS +PR EEAFFNQV+ LS+AGLLL ANAK+NA+Y+VHL Y
Sbjct: 441  WLLPADAESWRCTQTLDLKSSTEPRAEEAFFNQVIALSEAGLLLLANAKRNALYAVHLDY 500

Query: 308  GNNSAATRIDYIAEFTVTMPVLSFTGTIDPPSEHIIKLYCVQTQAIQQYSLNLFQCLPPP 367
            G++   TR+DY++EFTVTMP+LSF GT DPP E I+K+YCVQT AIQQY+L+L  CLPPP
Sbjct: 501  GSSPVGTRMDYLSEFTVTMPILSFIGTNDPPEEPIVKVYCVQTLAIQQYTLDLCLCLPPP 560

Query: 368  AESGGLERPDSSVSNDAN---------GSRLSEFLFPSSTSKPSF----SETTGAVRYPQ 414
             E+ GLE+ DSSVS +AN         G + ++     S  KPS     SE+   + +P 
Sbjct: 561  IENMGLEKSDSSVSREANLVEGMSEPSGLKPTDLPSVDSVPKPSIIVNRSESANKLSFP- 619

Query: 415  LSTSHEATTSQENLTSKTESQPLSLARTTSDTNVVCVASPPLPLSPSFSRKHSGSINPPN 474
               S EAT SQ  +    E +   L   TS         P LPLSP  S K SG   P  
Sbjct: 620  ---SAEAT-SQAIVPPNGEPKTSGLPSQTSGAGSAYATLPQLPLSPRLSSKLSGYHTPVE 675

Query: 475  SSELGSLLNEPGGSQPIIDSSFDGKTDTTQVLS-HVPSLDSDANNDKINIAPND-ISRAL 532
            + E     +E GG  P  D S D + D     +  V S++  + +   N+ P+D +S   
Sbjct: 676  AIEPVIPHHELGGKTPSADYSVDRQMDAVGERNLDVSSVEEISRSKDSNVTPDDDVSGMR 735

Query: 533  NPS-MFKHPTHLITPSEILMSASSSETTNIIGGKNEEEV---VVNSDAGNAEVEVKVLDE 588
            +PS  FKHPTHL+TPSEILM  SS+E +     + + +     VN+D  + EVEVK + E
Sbjct: 736  SPSAFFKHPTHLVTPSEILMGVSSAEASITTEDRRDRDANIQDVNNDPRDTEVEVKEISE 795

Query: 589  TRFTHD-EFGSRGESQNLVSENREKYLRYQATDPRIGMAAKCAGTSAETCVAEEAQEVDG 647
             R T + E     E++N  SENREK    Q ++    MA  C  ++  T +  E++    
Sbjct: 796  ARSTQNGEINDHDETENCTSENREKVFCSQVSNLSTEMARDCYPSTEGTFIPGESK---- 851

Query: 648  AGIMETLAQP-PCNDEAEVEDSTQDLDGGVSDSTMTTTFAQTGASSAKGKKQKEKKYQAS 706
                    QP    DE+ V     D  GG              A   KGKKQK K  Q  
Sbjct: 852  -----AYGQPIKAGDESGV-----DSRGG-------------PAKLLKGKKQKAKNSQGP 888

Query: 707  SQCSPSSTVLNLANLSNEPAGSSSLPSAPAAFSQVIAMQDMLNQLMTMQKELQKQMSNLV 766
               S SS V NLA+  NE + S S P       Q++AMQ+ +NQ+M  QKE+Q+Q+SN  
Sbjct: 889  GLSSTSSNVANLADSFNEQSQSLSHPMT-DLLPQLLAMQETMNQVMASQKEMQRQLSNAA 947

Query: 767  TLPVTKEGRRLEASLGRGIEKAVKASTDALWARFHEENARNEKLLRDRTQQITGLITNLI 826
            T P+ KE +RLE +LGR IEK+ K++ DALWAR  EE  +NEK LRD  QQI    TN +
Sbjct: 948  TGPIGKESKRLEVALGRMIEKSSKSNADALWARIQEETVKNEKALRDHAQQIVNATTNFM 1007

Query: 827  NKDLTASLEKLVKKELAAVGPAIVRTISPSIEKTITSAIVESFQRGVGDKAVNQLERSVN 886
            +K+L A  EK +KKELAA+GPA+ R++ P IEKT++SAI ESFQRG+GDKAVNQL++SVN
Sbjct: 1008 SKELNAMFEKTIKKELAAIGPALARSVVPVIEKTVSSAITESFQRGIGDKAVNQLDKSVN 1067

Query: 887  SRLEATVGRQIQAQFQTSGKHALQDALKSSVEASVIPAFEKSCKAMFEQVDATFQKGMVE 946
             +LEATV RQIQAQFQTSGK ALQ+ L+SSVE+SVIP+FEK+CKAMF+Q+D+ FQKG+ E
Sbjct: 1068 IKLEATVARQIQAQFQTSGKQALQEGLRSSVESSVIPSFEKACKAMFDQIDSAFQKGIAE 1127

Query: 947  HTTATLQHFESTHSPLALVLRESVNSVSSMAQTLSGEFVDGQRKLFDLAGVRNNTSAFNP 1006
            HT A  Q F+S HS LA  L+ES+ S SS+AQ LS E  + QR L  LA    N+   N 
Sbjct: 1128 HTNAAQQRFDSGHSQLAHTLKESITSASSVAQALSRELAETQRNLLALAAAGANSGGSNS 1187

Query: 1007 SVP-LSNGPLLGLHEKVEATMDPTKELSRLVSDRKYEEAFTTALQRSDVSIVSWLCSQVD 1065
             V  LS GPL  L EKVEA MDPT ELSRL+S+RKYEE+FT+ALQRSDVSIVSWLCSQVD
Sbjct: 1188 LVTQLSGGPLGALLEKVEAPMDPTTELSRLISERKYEESFTSALQRSDVSIVSWLCSQVD 1247

Query: 1066 MHGLLSMVPLPLSQGVLLSLLQQLACDINKDTARKLAWLTDVAAAINPADPMIAVHARPI 1125
            + GLL+M PLPLSQGVLLSLLQQLACDI+KDT+RKLAW+TDV AAINP+D MIAVHARPI
Sbjct: 1248 LRGLLAMNPLPLSQGVLLSLLQQLACDISKDTSRKLAWMTDVVAAINPSDQMIAVHARPI 1307

Query: 1126 FEQVYQRLHHQRSSPTISGAELSSIRLLIHVINSMLMTFK 1165
            FEQVYQ LHH R++P   G+++S+IRL++HVINSMLM  K
Sbjct: 1308 FEQVYQILHHHRNAP---GSDVSAIRLIMHVINSMLMGCK 1344

As a component of the decapping complex, involved in the degradation of mRNAs. Essential for postembryonic development, especially during the formation of the shoot (SAM) and root apical meristems. Required for normal patterning of internal tissues of leaves.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9LTT9\|VCR_ARATH Varicose-related protein OS=Arabidopsis thaliana GN=VCR PE=2 SV=1	Back alignment and function description

>sp\|Q7ZXT3\|EDC4_XENLA Enhancer of mRNA-decapping protein 4 OS=Xenopus laevis GN=edc4 PE=2 SV=1	Back alignment and function description

>sp\|Q6P2E9\|EDC4_HUMAN Enhancer of mRNA-decapping protein 4 OS=Homo sapiens GN=EDC4 PE=1 SV=1	Back alignment and function description

>sp\|Q1LUT1\|EDC4_DANRE Enhancer of mRNA-decapping protein 4 OS=Danio rerio GN=edc4 PE=2 SV=1	Back alignment and function description

>sp\|Q3ZAV8\|EDC4_RAT Enhancer of mRNA-decapping protein 4 OS=Rattus norvegicus GN=Edc4 PE=2 SV=1	Back alignment and function description

>sp\|Q3UJB9\|EDC4_MOUSE Enhancer of mRNA-decapping protein 4 OS=Mus musculus GN=Edc4 PE=1 SV=2	Back alignment and function description

>sp\|Q9VKK1\|EDC4_DROME Enhancer of mRNA-decapping protein 4 homolog OS=Drosophila melanogaster GN=Ge-1 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1165
356524411		1258	PREDICTED: enhancer of mRNA-decapping pr	0.829	0.767	0.599	0.0
449461114		1417	PREDICTED: enhancer of mRNA-decapping pr	0.829	0.681	0.598	0.0
449506590		1362	PREDICTED: enhancer of mRNA-decapping pr	0.829	0.709	0.597	0.0
225462062		1401	PREDICTED: enhancer of mRNA-decapping pr	0.830	0.690	0.616	0.0
357460315		1383	Enhancer of mRNA-decapping protein [Medi	0.829	0.698	0.576	0.0
255579558		1344	conserved hypothetical protein [Ricinus	0.8	0.693	0.597	0.0
356569595		1248	PREDICTED: uncharacterized protein LOC10	0.828	0.773	0.589	0.0
359496844		1373	PREDICTED: enhancer of mRNA-decapping pr	0.833	0.707	0.571	0.0
147774958		1357	hypothetical protein VITISV_010378 [Viti	0.796	0.683	0.580	0.0
255568504		1440	nucleotide binding protein, putative [Ri	0.833	0.674	0.542	0.0

>gi\|356524411\|ref\|XP_003530822.1\| PREDICTED: enhancer of mRNA-decapping protein 4-like [Glycine max]	Back alignment and taxonomy information

 Score = 1122 bits (2902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/1001 (59%), Positives = 735/1001 (73%), Gaps = 35/1001 (3%)

Query: 188  IKIWEDSKVAPLIILKPHGGQPVNSAQYLTAPNQAGHIILVTAGPLNREVKLWASASEEG 247
            IKIWED K  PL IL+PH G PV SA + TAP+Q  HI+L+TAGP NREVKLW SAS+EG
Sbjct: 270  IKIWEDRKTQPLAILRPHDGNPVFSATFFTAPHQPDHIVLITAGPQNREVKLWVSASDEG 329

Query: 248  WSLPTHAESWKCTQTLDLKSSAKPRVEEAFFNQVVVLSQAGLLLFANAKKNAIYSVHLGY 307
            W LP+  ESWKCTQTL+LKSSA+P  ++AFFNQV  LS AGLLL ANA++NAIY+VHL Y
Sbjct: 330  WLLPSDTESWKCTQTLELKSSAQPS-KDAFFNQVAALSHAGLLLLANAQRNAIYAVHLEY 388

Query: 308  GNNSAATRIDYIAEFTVTMPVLSFTGTID--PPSEHIIKLYCVQTQAIQQYSLNLFQCLP 365
            G+N  +TR+DYIAEFTVTMP+LSFTGT D  P  EHI+++YCVQTQAIQQY+L+L QCLP
Sbjct: 389  GSNPESTRMDYIAEFTVTMPILSFTGTSDILPHGEHIVQVYCVQTQAIQQYALDLAQCLP 448

Query: 366  PPAESGGLERPDSSVSND-----------ANGSRLSEFLFPSSTSKP----SFSETTGAV 410
            PP E+ GLE+ DSSVS D           ++  R +E    SS  K     S +E     
Sbjct: 449  PPYENVGLEKSDSSVSRDPITVEGFHSLDSSAGRTTEMSLASSAPKTMLQTSSNEGGLVA 508

Query: 411  RYPQLSTSH-EATTSQENLTSKTESQPLSLARTTSDTNVVCVASPPLPLSPSFSRKHSGS 469
            RYP LS+ H EA  S+   +S TE++P +L  ++SD ++VC+ S PLPLSP  SRK S  
Sbjct: 509  RYP-LSSGHVEAPISRGISSSNTEAKPATLPPSSSDADIVCIPSSPLPLSPRLSRKLS-D 566

Query: 470  INPPNSSELGSLLNEPGGSQPIIDSSFDGKTDTTQVLSHVPSLDSDANNDKINIAPNDIS 529
            I  P S+     L++  G  P+ D S D + DT       P L+SD+ ND+  +  +DIS
Sbjct: 567  IRSPQSN-----LSDHVGDHPVNDYSIDRQMDTIHRNLSDP-LNSDSKNDEKKMKQDDIS 620

Query: 530  RALNPS-MFKHPTHLITPSEILMSASSSETTNIIGGKNEEEVVVNS--DAGNAEVEVKVL 586
              LNPS +FK PTHLITPSEI  + SSSET NII  KNE E  +    D GNAEVEVKV+
Sbjct: 621  SVLNPSVLFKQPTHLITPSEITKAGSSSET-NIIDRKNEGEAKIQDVVDVGNAEVEVKVV 679

Query: 587  DETRFTH-DEFGSRGESQNLVSENREKYLRYQATDPRIGMAAKCAGTSAETCVAEEAQEV 645
             ETR    DEFG +G  Q  V++++EK    QA+D  I MA +C   S +T + EE  ++
Sbjct: 680  GETRSNQSDEFGGQGSQQPSVADSKEKLFCSQASDLGIEMARECCSISEDTYLMEEPGQL 739

Query: 646  DGAGIMETLAQPPCNDEAEVEDSTQDLDGGVSDSTMTTTFAQTGASSAKGKKQKEKKYQA 705
            D     ++LAQP    E  ++D  +D    VSDS+ +     + A +AKGK+QK K  Q 
Sbjct: 740  DSTTGGDSLAQPLDASEDGLQDFAKDAHEKVSDSSTSVAVPPSPAPNAKGKRQKGKNSQP 799

Query: 706  SSQCSPSSTVLNLANLSNEPAGSSSLPSAPAAFSQVIAMQDMLNQLMTMQKELQKQMSNL 765
            +   S   +  N  +  NEP G+SSLPSA  AF Q++AMQ+ LNQL+TMQKE+QKQM+ +
Sbjct: 800  AGPSSSFPSACNSTDSFNEPIGNSSLPSAENAFPQILAMQESLNQLLTMQKEMQKQMTMM 859

Query: 766  VTLPVTKEGRRLEASLGRGIEKAVKASTDALWARFHEENARNEKLLRDRTQQITGLITNL 825
            V +PVTKEGRRLEA+LGR +EKAVK+++DALWAR  EENA++EKLLRDR QQ+TGLI+N 
Sbjct: 860  VAVPVTKEGRRLEAALGRNMEKAVKSNSDALWARIQEENAKSEKLLRDRIQQVTGLISNF 919

Query: 826  INKDLTASLEKLVKKELAAVGPAIVRTISPSIEKTITSAIVESFQRGVGDKAVNQLERSV 885
            +NKDL   LEK VKKE+A+VG A+VR +SP++EK I+S+IVESFQRGVGDKAVNQL+RSV
Sbjct: 920  MNKDLPVILEKTVKKEMASVGQAVVRAMSPAVEKIISSSIVESFQRGVGDKAVNQLDRSV 979

Query: 886  NSRLEATVGRQIQAQFQTSGKHALQDALKSSVEASVIPAFEKSCKAMFEQVDATFQKGMV 945
            NS+LEATV RQIQAQFQT+GK  LQ+ALKSS E SV+PAFE SCKAMFEQVDATFQKGMV
Sbjct: 980  NSKLEATVARQIQAQFQTTGKQVLQEALKSSFETSVVPAFEMSCKAMFEQVDATFQKGMV 1039

Query: 946  EHTTATLQHFESTHSPLALVLRESVNSVSSMAQTLSGEFVDGQRKLFDLAGVRNNTSAFN 1005
            EH+TA  Q  ES  + LA+ LR+S+NS SS+ QTLS E ++GQRKL  LA  R N+   N
Sbjct: 1040 EHSTAVQQRLESAPTSLAMTLRDSINSASSITQTLSREVLEGQRKLVTLAATRTNSGTLN 1099

Query: 1006 P-SVPLSNGPLLGLHEKVEATMDPTKELSRLVSDRKYEEAFTTALQRSDVSIVSWLCSQV 1064
               V L+NGPL  LHEKVE  +DPT+EL+RL+S+RKYEEAF  AL RSDVSIVSWLC+QV
Sbjct: 1100 TLPVQLNNGPL--LHEKVEVPLDPTQELARLISERKYEEAFIGALHRSDVSIVSWLCTQV 1157

Query: 1065 DMHGLLSMVPLPLSQGVLLSLLQQLACDINKDTARKLAWLTDVAAAINPADPMIAVHARP 1124
            D+HGLLSMVPLPLSQGVLLSLLQQLACDIN DT RK+AWLTDVAAAINP+D  IA+H R 
Sbjct: 1158 DLHGLLSMVPLPLSQGVLLSLLQQLACDINNDTPRKIAWLTDVAAAINPSDLTIAMHTRS 1217

Query: 1125 IFEQVYQRLHHQRSSPTISGAELSSIRLLIHVINSMLMTFK 1165
            IFEQVYQ L+HQRS PT++GA+LSSIRLL+HVINSMLMT K
Sbjct: 1218 IFEQVYQILNHQRSLPTMTGADLSSIRLLLHVINSMLMTCK 1258

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449461114\|ref\|XP_004148288.1\| PREDICTED: enhancer of mRNA-decapping protein 4-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449506590\|ref\|XP_004162791.1\| PREDICTED: enhancer of mRNA-decapping protein 4-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|225462062\|ref\|XP_002269575.1\| PREDICTED: enhancer of mRNA-decapping protein 4-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357460315\|ref\|XP_003600439.1\| Enhancer of mRNA-decapping protein [Medicago truncatula] gi\|355489487\|gb\|AES70690.1\| Enhancer of mRNA-decapping protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|255579558\|ref\|XP_002530621.1\| conserved hypothetical protein [Ricinus communis] gi\|223529831\|gb\|EEF31764.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|356569595\|ref\|XP_003552984.1\| PREDICTED: uncharacterized protein LOC100802374 [Glycine max]	Back alignment and taxonomy information

>gi\|359496844\|ref\|XP_002269564.2\| PREDICTED: enhancer of mRNA-decapping protein 4-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147774958\|emb\|CAN72630.1\| hypothetical protein VITISV_010378 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255568504\|ref\|XP_002525226.1\| nucleotide binding protein, putative [Ricinus communis] gi\|223535523\|gb\|EEF37192.1\| nucleotide binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1165
TAIR\|locus:2088165		1344	VCS "AT3G13300" [Arabidopsis t	0.387	0.336	0.599	3.5e-268
UNIPROTKB\|E1BJH1		1404	EDC4 "Uncharacterized protein"	0.195	0.162	0.254	7.6e-19
RGD\|1562009		1407	Edc4 "enhancer of mRNA decappi	0.171	0.142	0.263	2.5e-18
MGI\|MGI:2446249		1406	Edc4 "enhancer of mRNA decappi	0.171	0.142	0.254	6.3e-18
DICTYBASE\|DDB_G0288241		1476	DDB_G0288241 "Enhancer of mRNA	0.187	0.147	0.246	7.7e-18
UNIPROTKB\|F1NKX2		1398	EDC4 "Uncharacterized protein"	0.193	0.160	0.236	1.4e-17
UNIPROTKB\|E2RKN5		1400	EDC4 "Uncharacterized protein"	0.197	0.164	0.225	6.6e-16
ZFIN\|ZDB-GENE-030131-5032		1384	edc4 "enhancer of mRNA decappi	0.329	0.277	0.188	3.2e-14
UNIPROTKB\|Q6P2E9		1401	EDC4 "Enhancer of mRNA-decappi	0.185	0.154	0.256	4.2e-13
CGD\|CAL0003874		1404	PGA55 [Candida albicans (taxid	0.586	0.486	0.172	6e-06

TAIR\|locus:2088165 VCS "AT3G13300" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1345 (478.5 bits), Expect = 3.5e-268, Sum P(4) = 3.5e-268
 Identities = 274/457 (59%), Positives = 337/457 (73%)

Query:   710 SPSSTVLNLANLSNEXXXXXXXXXXXXXFSQVIAMQDMLNQLMTMQKELQKQMSNLVTLP 769
             S SS V NLA+  NE               Q++AMQ+ +NQ+M  QKE+Q+Q+SN  T P
Sbjct:   892 STSSNVANLADSFNEQSQSLSHPMTDL-LPQLLAMQETMNQVMASQKEMQRQLSNAATGP 950

Query:   770 VTKEGRRLEASLGRGIEKAVKASTDALWARFHEENARNEKLLRDRTQQITGLITNLINKD 829
             + KE +RLE +LGR IEK+ K++ DALWAR  EE  +NEK LRD  QQI    TN ++K+
Sbjct:   951 IGKESKRLEVALGRMIEKSSKSNADALWARIQEETVKNEKALRDHAQQIVNATTNFMSKE 1010

Query:   830 LTASLEKLVKKELAAVGPAIVRTISPSIEKTITSAIVESFQRGVGDKAVNQLERSVNSRL 889
             L A  EK +KKELAA+GPA+ R++ P IEKT++SAI ESFQRG+GDKAVNQL++SVN +L
Sbjct:  1011 LNAMFEKTIKKELAAIGPALARSVVPVIEKTVSSAITESFQRGIGDKAVNQLDKSVNIKL 1070

Query:   890 EATVGRQIQAQFQTSGKHALQDALKSSVEASVIPAFEKSCKAMFEQVDATFQKGMVEHTT 949
             EATV RQIQAQFQTSGK ALQ+ L+SSVE+SVIP+FEK+CKAMF+Q+D+ FQKG+ EHT 
Sbjct:  1071 EATVARQIQAQFQTSGKQALQEGLRSSVESSVIPSFEKACKAMFDQIDSAFQKGIAEHTN 1130

Query:   950 ATLQHFESTHSPLALVLRESVNSVSSMAQTLSGEFVDGQRKLFDLAGVRNNTSAFNPSVP 1009
             A  Q F+S HS LA  L+ES+ S SS+AQ LS E  + QR L  LA    N+   N  V 
Sbjct:  1131 AAQQRFDSGHSQLAHTLKESITSASSVAQALSRELAETQRNLLALAAAGANSGGSNSLVT 1190

Query:  1010 -LSNGPLLGLHEKVEATMDPTKELSRLVSDRKYEEAFTTALQRSDVSIVSWLCSQVDMHG 1068
              LS GPL  L EKVEA MDPT ELSRL+S+RKYEE+FT+ALQRSDVSIVSWLCSQVD+ G
Sbjct:  1191 QLSGGPLGALLEKVEAPMDPTTELSRLISERKYEESFTSALQRSDVSIVSWLCSQVDLRG 1250

Query:  1069 LLSMXXXXXXXXXXXXXXXXXACDINKDTARKLAWLTDVAAAINPADPMIAVHARPIFEQ 1128
             LL+M                 ACDI+KDT+RKLAW+TDV AAINP+D MIAVHARPIFEQ
Sbjct:  1251 LLAMNPLPLSQGVLLSLLQQLACDISKDTSRKLAWMTDVVAAINPSDQMIAVHARPIFEQ 1310

Query:  1129 VYQRLHHQRSSPTISGAELSSIRLLIHVINSMLMTFK 1165
             VYQ LHH R++P   G+++S+IRL++HVINSMLM  K
Sbjct:  1311 VYQILHHHRNAP---GSDVSAIRLIMHVINSMLMGCK 1344

GO:0000166 "nucleotide binding" evidence=ISS

GO:0005634 "nucleus" evidence=ISM;IDA

GO:0009965 "leaf morphogenesis" evidence=IMP

GO:0010071 "root meristem specification" evidence=IMP

GO:0010072 "primary shoot apical meristem specification" evidence=IMP

GO:0071365 "cellular response to auxin stimulus" evidence=IMP

GO:0000932 "cytoplasmic mRNA processing body" evidence=IDA

GO:0005515 "protein binding" evidence=IPI

GO:0031087 "deadenylation-independent decapping of nuclear-transcribed mRNA" evidence=IDA

GO:0006402 "mRNA catabolic process" evidence=IMP

GO:0009791 "post-embryonic development" evidence=IMP

GO:0042803 "protein homodimerization activity" evidence=IPI

GO:0005829 "cytosol" evidence=IDA

UNIPROTKB\|E1BJH1 EDC4 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

RGD\|1562009 Edc4 "enhancer of mRNA decapping 4" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:2446249 Edc4 "enhancer of mRNA decapping 4" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0288241 DDB_G0288241 "Enhancer of mRNA-decapping protein 4" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NKX2 EDC4 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RKN5 EDC4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-5032 edc4 "enhancer of mRNA decapping 4" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6P2E9 EDC4 "Enhancer of mRNA-decapping protein 4" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

CGD\|CAL0003874 PGA55 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9LTT8	VCS_ARATH	No assigned EC number	0.531	0.8085	0.7008	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1165
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	5e-04
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	0.001

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

 Score = 44.2 bits (104), Expect = 5e-04
 Identities = 19/64 (29%), Positives = 21/64 (32%), Gaps = 6/64 (9%)

Query: 24   PPYPPPSSSAAGDNFFPYPPPPPPPPPEPHANMHPHPYPHGPHRLLPYTPLPTTTVVSPN 83
            P     + S      F  PP  P  PP+P A   P P P  P    P  P P      P 
Sbjct: 2889 PAVSRSTES------FALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPP 2942

Query: 84   AGPQ 87
              P 
Sbjct: 2943 LAPT 2946

Length = 3151

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1165
KOG1916		1283	consensus Nuclear protein, contains WD40 repeats [	100.0
KOG1916		1283	consensus Nuclear protein, contains WD40 repeats [	99.69
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	99.47
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	99.36
KOG0266		456	consensus WD40 repeat-containing protein [General	99.29
KOG0275		508	consensus Conserved WD40 repeat-containing protein	99.25
KOG0295		406	consensus WD40 repeat-containing protein [Function	99.25
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	99.2
KOG0266		456	consensus WD40 repeat-containing protein [General	99.18
KOG0263		707	consensus Transcription initiation factor TFIID, s	99.17
KOG0279		315	consensus G protein beta subunit-like protein [Sig	99.13
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	99.12
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	99.08
KOG0295		406	consensus WD40 repeat-containing protein [Function	99.05
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	99.03
PTZ00421		493	coronin; Provisional	99.02
KOG0263		707	consensus Transcription initiation factor TFIID, s	99.01
PTZ00421		493	coronin; Provisional	98.98
KOG0316		307	consensus Conserved WD40 repeat-containing protein	98.97
KOG0279		315	consensus G protein beta subunit-like protein [Sig	98.96
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	98.96
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	98.95
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	98.91
PTZ00420		568	coronin; Provisional	98.9
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	98.89
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	98.89
PTZ00420		568	coronin; Provisional	98.88
PLN00181		793	protein SPA1-RELATED; Provisional	98.87
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	98.87
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	98.84
KOG0293		519	consensus WD40 repeat-containing protein [Function	98.83
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	98.82
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	98.82
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	98.8
PLN00181		793	protein SPA1-RELATED; Provisional	98.8
KOG0286		343	consensus G-protein beta subunit [General function	98.76
KOG0284		464	consensus Polyadenylation factor I complex, subuni	98.75
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	98.73
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	98.73
KOG0286		343	consensus G-protein beta subunit [General function	98.71
KOG0315		311	consensus G-protein beta subunit-like protein (con	98.7
KOG0973		942	consensus Histone transcription regulator HIRA, WD	98.64
KOG0288		459	consensus WD40 repeat protein TipD [General functi	98.63
KOG0283		712	consensus WD40 repeat-containing protein [Function	98.62
KOG0639		705	consensus Transducin-like enhancer of split protei	98.61
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	98.59
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	98.57
KOG0289		506	consensus mRNA splicing factor [General function p	98.57
KOG0294		362	consensus WD40 repeat-containing protein [Function	98.57
KOG0318		603	consensus WD40 repeat stress protein/actin interac	98.51
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	98.5
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	98.5
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	98.47
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	98.46
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	98.43
KOG0645		312	consensus WD40 repeat protein [General function pr	98.41
KOG0310		487	consensus Conserved WD40 repeat-containing protein	98.41
KOG0308		735	consensus Conserved WD40 repeat-containing protein	98.4
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	98.38
KOG0640		430	consensus mRNA cleavage stimulating factor complex	98.38
KOG0310		487	consensus Conserved WD40 repeat-containing protein	98.38
KOG0293		519	consensus WD40 repeat-containing protein [Function	98.36
KOG0284		464	consensus Polyadenylation factor I complex, subuni	98.34
KOG0315		311	consensus G-protein beta subunit-like protein (con	98.32
KOG0300		481	consensus WD40 repeat-containing protein [Function	98.31
KOG1539		910	consensus WD repeat protein [General function pred	98.3
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	98.27
KOG0296		399	consensus Angio-associated migratory cell protein	98.26
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	98.26
KOG0301		745	consensus Phospholipase A2-activating protein (con	98.24
KOG0641		350	consensus WD40 repeat protein [General function pr	98.24
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	98.21
KOG0640		430	consensus mRNA cleavage stimulating factor complex	98.2
KOG0647		347	consensus mRNA export protein (contains WD40 repea	98.2
KOG0646		476	consensus WD40 repeat protein [General function pr	98.19
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	98.16
KOG0308		735	consensus Conserved WD40 repeat-containing protein	98.15
KOG0267		825	consensus Microtubule severing protein katanin p80	98.14
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	98.12
KOG1273		405	consensus WD40 repeat protein [General function pr	98.11
KOG0302		440	consensus Ribosome Assembly protein [General funct	98.09
KOG0296		399	consensus Angio-associated migratory cell protein	98.08
KOG0269		839	consensus WD40 repeat-containing protein [Function	98.07
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	98.06
PRK11028		330	6-phosphogluconolactonase; Provisional	98.04
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	98.04
KOG0289		506	consensus mRNA splicing factor [General function p	98.04
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	98.03
KOG0302		440	consensus Ribosome Assembly protein [General funct	98.03
KOG0282		503	consensus mRNA splicing factor [Function unknown]	98.02
KOG1924		1102	consensus RhoA GTPase effector DIA/Diaphanous [Sig	98.02
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	97.95
KOG0282		503	consensus mRNA splicing factor [Function unknown]	97.94
KOG0321		720	consensus WD40 repeat-containing protein L2DTL [Fu	97.94
KOG4283		397	consensus Transcription-coupled repair protein CSA	97.94
KOG0278		334	consensus Serine/threonine kinase receptor-associa	97.93
KOG0644		1113	consensus Uncharacterized conserved protein, conta	97.91
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	97.89
KOG4283		397	consensus Transcription-coupled repair protein CSA	97.87
KOG0267		825	consensus Microtubule severing protein katanin p80	97.86
KOG0301		745	consensus Phospholipase A2-activating protein (con	97.85
KOG0772		641	consensus Uncharacterized conserved protein, conta	97.85
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	97.84
KOG0649		325	consensus WD40 repeat protein [General function pr	97.83
KOG0270		463	consensus WD40 repeat-containing protein [Function	97.83
KOG0303		472	consensus Actin-binding protein Coronin, contains	97.82
KOG0643		327	consensus Translation initiation factor 3, subunit	97.82
KOG0275		508	consensus Conserved WD40 repeat-containing protein	97.79
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	97.75
KOG0303		472	consensus Actin-binding protein Coronin, contains	97.74
KOG1332		299	consensus Vesicle coat complex COPII, subunit SEC1	97.7
KOG0278		334	consensus Serine/threonine kinase receptor-associa	97.69
KOG2139		445	consensus WD40 repeat protein [General function pr	97.66
KOG4328		498	consensus WD40 protein [Function unknown]	97.66
KOG0288		459	consensus WD40 repeat protein TipD [General functi	97.66
KOG1063		764	consensus RNA polymerase II elongator complex, sub	97.63
KOG0645		312	consensus WD40 repeat protein [General function pr	97.61
KOG1332		299	consensus Vesicle coat complex COPII, subunit SEC1	97.6
KOG1407		313	consensus WD40 repeat protein [Function unknown]	97.58
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	97.55
KOG1274		933	consensus WD40 repeat protein [General function pr	97.55
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	97.54
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	97.53
KOG0646		476	consensus WD40 repeat protein [General function pr	97.52
KOG0973		942	consensus Histone transcription regulator HIRA, WD	97.52
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	97.51
KOG0270		463	consensus WD40 repeat-containing protein [Function	97.5
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	97.48
KOG1188		376	consensus WD40 repeat protein [General function pr	97.46
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	97.45
KOG0294		362	consensus WD40 repeat-containing protein [Function	97.45
KOG2048		691	consensus WD40 repeat protein [General function pr	97.44
PRK11028		330	6-phosphogluconolactonase; Provisional	97.41
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	97.38
KOG0643		327	consensus Translation initiation factor 3, subunit	97.36
KOG0321		720	consensus WD40 repeat-containing protein L2DTL [Fu	97.36
KOG0316		307	consensus Conserved WD40 repeat-containing protein	97.35
KOG1007		370	consensus WD repeat protein TSSC1, WD repeat super	97.34
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	97.32
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	97.31
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	97.3
KOG0639		705	consensus Transducin-like enhancer of split protei	97.29
KOG0772		641	consensus Uncharacterized conserved protein, conta	97.29
KOG0269		839	consensus WD40 repeat-containing protein [Function	97.28
COG2319		466	FOG: WD40 repeat [General function prediction only	97.24
KOG0322		323	consensus G-protein beta subunit-like protein GNB1	97.21
KOG2096		420	consensus WD40 repeat protein [General function pr	97.21
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	97.2
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	97.18
KOG0300		481	consensus WD40 repeat-containing protein [Function	97.12
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	97.12
KOG0641		350	consensus WD40 repeat protein [General function pr	96.95
KOG0771		398	consensus Prolactin regulatory element-binding pro	96.9
COG2319		466	FOG: WD40 repeat [General function prediction only	96.84
KOG1036		323	consensus Mitotic spindle checkpoint protein BUB3,	96.82
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	96.81
PRK01742		429	tolB translocation protein TolB; Provisional	96.76
KOG1274		933	consensus WD40 repeat protein [General function pr	96.76
KOG4328		498	consensus WD40 protein [Function unknown]	96.76
PRK04922		433	tolB translocation protein TolB; Provisional	96.74
KOG0649		325	consensus WD40 repeat protein [General function pr	96.74
KOG4547		541	consensus WD40 repeat-containing protein [General	96.71
KOG2096		420	consensus WD40 repeat protein [General function pr	96.69
KOG0642		577	consensus Cell-cycle nuclear protein, contains WD-	96.64
KOG0974		967	consensus WD-repeat protein WDR6, WD repeat superf	96.62
PRK01742		429	tolB translocation protein TolB; Provisional	96.57
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	96.56
KOG2048		691	consensus WD40 repeat protein [General function pr	96.55
KOG2111		346	consensus Uncharacterized conserved protein, conta	96.53
KOG1036		323	consensus Mitotic spindle checkpoint protein BUB3,	96.52
KOG2055		514	consensus WD40 repeat protein [General function pr	96.49
PRK05137		435	tolB translocation protein TolB; Provisional	96.45
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	96.4
KOG3914		390	consensus WD repeat protein WDR4 [Function unknown	96.39
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	96.37
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	96.37
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	96.34
KOG0283		712	consensus WD40 repeat-containing protein [Function	96.32
KOG2110		391	consensus Uncharacterized conserved protein, conta	96.21
KOG0647		347	consensus mRNA export protein (contains WD40 repea	96.18
PRK03629		429	tolB translocation protein TolB; Provisional	96.17
KOG4227		609	consensus WD40 repeat protein [General function pr	96.15
KOG2321		703	consensus WD40 repeat protein [General function pr	96.11
KOG0318		603	consensus WD40 repeat stress protein/actin interac	96.06
KOG2445		361	consensus Nuclear pore complex component (sc Seh1)	96.04
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	95.97
KOG3881		412	consensus Uncharacterized conserved protein [Funct	95.95
PRK02889		427	tolB translocation protein TolB; Provisional	95.94
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	95.85
KOG1272		545	consensus WD40-repeat-containing subunit of the 18	95.83
KOG1063		764	consensus RNA polymerase II elongator complex, sub	95.8
PRK04922		433	tolB translocation protein TolB; Provisional	95.79
KOG1273		405	consensus WD40 repeat protein [General function pr	95.77
KOG0290		364	consensus Conserved WD40 repeat-containing protein	95.71
KOG2394		636	consensus WD40 protein DMR-N9 [General function pr	95.67
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	95.64
PRK04792		448	tolB translocation protein TolB; Provisional	95.51
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	95.47
PRK03629		429	tolB translocation protein TolB; Provisional	95.39
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	95.14
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	95.08
KOG2110		391	consensus Uncharacterized conserved protein, conta	94.99
KOG1407		313	consensus WD40 repeat protein [Function unknown]	94.94
KOG2314		698	consensus Translation initiation factor 3, subunit	94.88
PRK05137		435	tolB translocation protein TolB; Provisional	94.65
KOG0644		1113	consensus Uncharacterized conserved protein, conta	94.61
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	94.56
KOG0642		577	consensus Cell-cycle nuclear protein, contains WD-	94.52
PRK00178		430	tolB translocation protein TolB; Provisional	94.51
KOG1188		376	consensus WD40 repeat protein [General function pr	94.33
KOG1923		830	consensus Rac1 GTPase effector FRL [Signal transdu	94.32
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	94.26
KOG2445		361	consensus Nuclear pore complex component (sc Seh1)	94.24
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	94.17
PRK02889		427	tolB translocation protein TolB; Provisional	94.12
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	94.08
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	94.01
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	93.89
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	93.83
PRK01029		428	tolB translocation protein TolB; Provisional	93.64
PF06705		247	SF-assemblin: SF-assemblin/beta giardin	93.63
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	93.56
KOG2695		425	consensus WD40 repeat protein [General function pr	93.47
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	93.3
KOG1007		370	consensus WD repeat protein TSSC1, WD repeat super	93.01
KOG0290		364	consensus Conserved WD40 repeat-containing protein	92.93
KOG1539		910	consensus WD repeat protein [General function pred	92.92
KOG1310		758	consensus WD40 repeat protein [General function pr	92.71
KOG2055		514	consensus WD40 repeat protein [General function pr	92.35
KOG1310		758	consensus WD40 repeat protein [General function pr	92.28
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	92.21
KOG1587		555	consensus Cytoplasmic dynein intermediate chain [C	92.06
PRK00178		430	tolB translocation protein TolB; Provisional	92.01
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	91.97
COG5170		460	CDC55 Serine/threonine protein phosphatase 2A, reg	91.79
KOG0322		323	consensus G-protein beta subunit-like protein GNB1	91.78
KOG3671		569	consensus Actin regulatory protein (Wiskott-Aldric	91.7
KOG2106		626	consensus Uncharacterized conserved protein, conta	91.12
COG5178		2365	PRP8 U5 snRNP spliceosome subunit [RNA processing	90.89
KOG1272		545	consensus WD40-repeat-containing subunit of the 18	90.84
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	90.82
PRK04792		448	tolB translocation protein TolB; Provisional	90.74
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	90.59
KOG2236		483	consensus Uncharacterized conserved protein [Funct	90.41
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	90.16
KOG3881		412	consensus Uncharacterized conserved protein [Funct	89.93
PRK01029		428	tolB translocation protein TolB; Provisional	89.63
KOG1963		792	consensus WD40 repeat protein [General function pr	89.51
KOG1923		830	consensus Rac1 GTPase effector FRL [Signal transdu	89.39
KOG4190		1034	consensus Uncharacterized conserved protein [Funct	89.19
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	89.1
KOG2675		480	consensus Adenylate cyclase-associated protein (CA	88.92
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	88.72
smart00320		40	WD40 WD40 repeats. Note that these repeats are per	88.25
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	87.88
KOG1354		433	consensus Serine/threonine protein phosphatase 2A,	87.77
KOG0280		339	consensus Uncharacterized conserved protein [Amino	87.64
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	87.49
KOG1409		404	consensus Uncharacterized conserved protein, conta	87.46
KOG1830		518	consensus Wiskott Aldrich syndrome proteins [Cytos	86.51
KOG1912		1062	consensus WD40 repeat protein [General function pr	86.26
PRK15319		2039	AIDA autotransporter-like protein ShdA; Provisiona	86.12
KOG2139		445	consensus WD40 repeat protein [General function pr	85.58
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	85.48
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	85.3
KOG1963		792	consensus WD40 repeat protein [General function pr	85.18
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	84.4
KOG2106		626	consensus Uncharacterized conserved protein, conta	84.23
KOG1334		559	consensus WD40 repeat protein [General function pr	83.6
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	83.04
KOG0771		398	consensus Prolactin regulatory element-binding pro	82.93
KOG2695		425	consensus WD40 repeat protein [General function pr	82.91
KOG1587		555	consensus Cytoplasmic dynein intermediate chain [C	82.66
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	82.33
COG4946		668	Uncharacterized protein related to the periplasmic	81.41
smart00320		40	WD40 WD40 repeats. Note that these repeats are per	81.13
KOG0132		894	consensus RNA polymerase II C-terminal domain-bind	81.13
KOG0974		967	consensus WD-repeat protein WDR6, WD repeat superf	81.11
KOG2079		1206	consensus Vacuolar assembly/sorting protein VPS8 [	80.57

>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=1.1e-153  Score=1337.39  Aligned_cols=1077  Identities=44%  Similarity=0.656  Sum_probs=923.7

Q ss_pred             cCCCCCCCccccccccccCCCCCCCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCC-----------CCCCCCCCC
Q 001070            6 QSQSPNQNQKQFDMRNWFPPYPPPSSSAAGDNFFPYP------PPPPPPPPEPHANMHPH-----------PYPHGPHRL   68 (1165)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~ppp~p~p~~~~~~~~~-----------~~~~~~~~~   68 (1165)
                      .+.+..+|.++||..++|-|-++|.++..|++-+.--      ||--.--|   -+-+-.           .+-.-+.++
T Consensus         5 psnt~p~~~p~~dlg~l~~P~~~~~~~~t~p~~n~Q~~qvi~~~~~~s~t~---~gV~~~~~~vvsss~~t~~~~~Rt~~   81 (1283)
T KOG1916|consen    5 PSNTNPHNKPPFDLGNLFKPSSNPYPPPTGPFLNNQYCQVIYAPPGISATP---SGVHQRQQDVVSSSNATNLKPQRTLS   81 (1283)
T ss_pred             CCCCCCCCCChhhcccccCCCCCCCCCCCCchhhhhhceeEecCCCccccc---cccccccchhhccccccccchhhhcc
Confidence            4556678999999999999999998874444333211      11111000   011110           122245888


Q ss_pred             CCCCC-CCCCCCCCCCChHHHHHhhcCC-------CCC--CC---------CCCCCC--------CceeecCCceEEecc
Q 001070           69 LPYTP-LPTTTVVSPNAGPQILALLNNN-------KSK--HV---------GSTAPI--------YGKRVFGDYVAYDVD  121 (1165)
Q Consensus        69 ~~~~~-~~~~~~~~~~~~~~~~~~l~~~-------~~~--~~---------~~~~p~--------~Gr~l~g~~~~~dVd  121 (1165)
                      ||.|| ....+..+.|+|..|.++|++-       |++  |.         +..+|+        +||++.|++.|||||
T Consensus        82 yp~~pva~~~~~~~~~yg~~I~~~~~~~~~~vrvaN~~~sm~~~~l~kgf~G~v~dl~fah~~~pk~~~~vg~lfVy~vd  161 (1283)
T KOG1916|consen   82 YPTPPVAVQSPRKNHNYGTHILALLNGMENGVRVANQEPSMRHNELAKGFPGGVGDLQFAHTKCPKGRRLVGELFVYDVD  161 (1283)
T ss_pred             CCCCcccccCcccccchHHHHHHHhhchhhhhhhccCcchhHHHHHHhcCCCCcccccccccCChHHHHHhhhhheeehH
Confidence            88888 4448889999999999999632       555  21         234555        999999999999999


Q ss_pred             cCCCCCCCCCCcccccccccCCCcccccccEeeecCceEEEeecCCcEEEEeCcchhhHhhcCCcc--------------
Q 001070          122 AVEEGREPTQQLEVNPITKYGSDPELLIGRQIAVNKHYVCYGLKGGNVRVLNLNTATRSLLRGHTK--------------  187 (1165)
Q Consensus       122 ~~~~ge~~~pqlev~pIt~Y~sd~~~~~GR~IAVn~~yIayG~kdg~IRVwdi~t~ir~llrGH~q--------------  187 (1165)
                      + ..||.| |+|+|+||++|++++.++.|++|+||..|||||.++|.||+++|+++.|.+||||++              
T Consensus       162 ~-l~G~iq-~~l~v~~~~p~gs~~~~V~wcp~~~~~~~ic~~~~~~~i~lL~~~ra~~~l~rsHs~~~~d~a~~~~g~~~  239 (1283)
T KOG1916|consen  162 V-LQGEIQ-PQLEVTPITPYGSDPQLVSWCPIAVNKVYICYGLKGGEIRLLNINRALRSLFRSHSQRVTDMAFFAEGVLK  239 (1283)
T ss_pred             h-hccccc-cceEEeecCcCCCCcceeeecccccccceeeeccCCCceeEeeechHHHHHHHhcCCCcccHHHHhhchhh
Confidence            9 999999 999999999999999999999999999999999999999999999999999999999              


Q ss_pred             --------------------------------------------------------------------------------
Q 001070          188 --------------------------------------------------------------------------------  187 (1165)
Q Consensus       188 --------------------------------------------------------------------------------  187 (1165)
                                                                                                      
T Consensus       240 l~~lSpDGtv~a~a~~dG~v~f~Qiyi~g~~~~rclhewkphd~~p~vC~lc~~~~~~~v~i~~w~~~Itttd~nre~k~  319 (1283)
T KOG1916|consen  240 LASLSPDGTVFAWAISDGSVGFYQIYITGKIVHRCLHEWKPHDKHPRVCWLCHKQEILVVSIGKWVLRITTTDVNREEKF  319 (1283)
T ss_pred             heeeCCCCcEEEEeecCCccceeeeeeeccccHhhhhccCCCCCCCceeeeeccccccCCccceeEEEEecccCCcceeE
Confidence                                                                                            


Q ss_pred             ------------------------------------------------EEEeecCCCceeEEecCCCCCCcceeEeecCC
Q 001070          188 ------------------------------------------------IKIWEDSKVAPLIILKPHGGQPVNSAQYLTAP  219 (1165)
Q Consensus       188 ------------------------------------------------VriWD~~~g~pl~~lephdG~sV~SVaFl~aP  219 (1165)
                                                                      |+||..++.+|+.+.+||+||+|.|..|.++|
T Consensus       320 w~~a~w~Cll~~~~d~v~iV~p~~~~v~~~~~~~~~~~~~v~r~v~~~i~~~qn~~a~~~~vs~~~~~hpV~S~i~v~S~  399 (1283)
T KOG1916|consen  320 WAEAPWQCLLDKLIDGVQIVGPHDGEVTDLSMCQWMTTRLVSRSVDGTIKIWQNRKAQPLVVSRPHDGHPVLSAIFVTSP  399 (1283)
T ss_pred             eeccchhhhhhhcccceEeecCCCccccchhhhHHHHHHHHHhhhHHHHHHhhcchhhhhhhhhhhhcceeccccccccC
Confidence                                                            77888888889999999999999999999999


Q ss_pred             CCCCceEEEeecCCCceEEEeEccCcCCCCCCCCCCC-cceEEE-E-eccCCCCCccccccEEEEEeecCCcEEEEeccC
Q 001070          220 NQAGHIILVTAGPLNREVKLWASASEEGWSLPTHAES-WKCTQT-L-DLKSSAKPRVEEAFFNQVVVLSQAGLLLFANAK  296 (1165)
Q Consensus       220 ~~~d~~~lvtsGslnrtIKLW~~a~~~~~~~~~~~~~-w~C~QT-L-e~~~s~~~~~~~aff~sV~~~p~a~~ilLan~~  296 (1165)
                      ++++|+.++++|++||++|+|..++.+||+.+++.+. |+|+|| | .+.++.|+..++||||+|..+...+++++| ++
T Consensus       400 ~R~~h~e~~~~~~~nr~~~i~~s~g~~g~ls~a~v~~k~rcv~tklqd~~~~~ePq~~~d~~n~~~als~h~~~~~a-~s  478 (1283)
T KOG1916|consen  400 ERPDHIELITGGPLNRELKIWVSAGEEGWLSPADVESKWRCVQTKLQDLKSSTEPQAEPDFFNQVIALSEHGLLLLA-AS  478 (1283)
T ss_pred             CCccccccccCCcchhhhhhhhhcccccccchhhhhhhHHHhhhhhhhcccccCCccchhhhcchHHHHHHHHHHHh-hh
Confidence            9999999999999999999999999999999999986 999999 7 678889999999999999999999999999 99


Q ss_pred             CCcEEEEEeecCCCccccccccccccccccceeeeeeccCCCCcceEEEEEeehhhhhhhccccccccCCCCCCCCCCCC
Q 001070          297 KNAIYSVHLGYGNNSAATRIDYIAEFTVTMPVLSFTGTIDPPSEHIIKLYCVQTQAIQQYSLNLFQCLPPPAESGGLERP  376 (1165)
Q Consensus       297 r~aIYalhl~~g~~~~~~r~dyiaeF~v~~PILSft~~~d~~ge~~vq~yCvQtqAIQqy~l~~~~c~pp~~~~~~~e~~  376 (1165)
                      ||++|.+|++|+..+.-++||||.||+++||||||. +.|+..+-.+++|||||-|||||.++      |+.+++|++++
T Consensus       479 r~el~sv~l~~~a~~~e~~~~~~~e~~~p~d~Ls~~-te~pp~~~~~~v~~vqt~alqq~Ta~------p~r~s~Gssss  551 (1283)
T KOG1916|consen  479 RNELYSVHLDYGASPVETDMDYLSEFTVPMDILSFI-TEDPPEEPTVKVYCVQTLALQQYTAD------PPRESSGSSSS  551 (1283)
T ss_pred             hhhhhhccCCcccCCCcchhhhhhhcCCCccceeec-cCCCCCCCCCceeeeehHHHHHHhcC------CcccccCcccc
Confidence            999999999999999999999999999999999999 88888999999999999999999999      77899999999


Q ss_pred             CCCccccc-cCC---cccccccCCCCCCCCcccccCccccCCCCCCccccccccccCCCCCCCCcccccccCCCcccccC
Q 001070          377 DSSVSNDA-NGS---RLSEFLFPSSTSKPSFSETTGAVRYPQLSTSHEATTSQENLTSKTESQPLSLARTTSDTNVVCVA  452 (1165)
Q Consensus       377 ~~~~s~~~-~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  452 (1165)
                      +++|||.+ .++   -+.-+..+...++|+.+..+++.....+++...+ +...++.++.+++.       +.+.+++++
T Consensus       552 ~ssvs~~a~av~sms~tsa~kpt~~~p~P~~l~~~s~~~n~~S~~a~sa-ss~aa~p~~~~p~t-------s~~p~a~~~  623 (1283)
T KOG1916|consen  552 DSSVSREANAVESMSETSAVKPTLLPPKPSILVNRSELANDLSFPASSA-SSLAAVPPNGEPKT-------SGAPSAYAL  623 (1283)
T ss_pred             hhHHHHHhhhhhhhcccccCCcccCCCCchhhhccHhhhhccCCCcccc-ccccccCCCCCCCC-------CCCCccccc
Confidence            99999976 443   2223333444578999999999877777766665 33557777777776       223367788


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccCCCcCCCcccccc-cccCCCCCCCCCcccccCCCCC-ccc
Q 001070          453 SPPLPLSPSFSRKHSGSINPPNSSELGSLLNEPGGSQPIIDSSFDGKTDTTQV-LSHVPSLDSDANNDKINIAPND-ISR  530 (1165)
Q Consensus       453 s~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~d-~~~  530 (1165)
                      ||.+|.  ++++++|++..+-..+|+..+....++++++.|| +.++++++.. ..|+-+.+.+.|+.+.++..+| .+.
T Consensus       624 sp~~pg--q~~S~~Sa~~~~v~~~epv~~~~~~~~~t~s~d~-vi~~~~~v~~r~~~~~s~e~~sR~k~s~v~~~~e~~~  700 (1283)
T KOG1916|consen  624 SPQLPG--QLSSKLSAYHTPVEAVEPVGPHHALGGKTRSADY-VIRQADTVGSRNLDVSSVEELSRSKDSNVTPDDEVSG  700 (1283)
T ss_pred             CCCCCC--cccchhhhhhhhHHhhcccCCcccCCCCCcchHH-HhhhcchhhcccchhHHHHHhhhcccCCCCCCCCcch
Confidence            899988  8999999999999999999999999999999999 9999999998 6677788899999888888554 677


Q ss_pred             CCCCCCCCCCCcccChhHhhhccCCCCcc--cccCCccccceeeccCCCCcceeEEEeccCcccc-cccCcccccchhhh
Q 001070          531 ALNPSMFKHPTHLITPSEILMSASSSETT--NIIGGKNEEEVVVNSDAGNAEVEVKVLDETRFTH-DEFGSRGESQNLVS  607 (1165)
Q Consensus       531 ~~~~~~f~~~~hl~tpsei~~~~~~s~~~--~~~~~~~~~~v~~~~~~~~~e~~~k~v~~~~~~~-~~~~~~~~~~~~~~  607 (1165)
                      +.+|..   ||||+||+   +.+..+=++  ..+++.++.||  |||.+..|||+|.++++...| ++...+-...+...
T Consensus       701 m~s~as---~~hl~SP~---~~~~~~i~tqd~~D~~~~~~d~--~ndp~dlE~el~~~ss~~~sqv~~t~p~it~e~cSs  772 (1283)
T KOG1916|consen  701 MRSPAS---PTHLVSPV---SSPEASITTQDGRDRDANIGDV--NNDPRDLEVELKEESSAPDSQVGETNPHITTENCSS  772 (1283)
T ss_pred             hhCccc---ccccCCCC---CCcccccccccccccCcccccc--cCCcchhHHHHHhccCCCccccCCCCCcccccccch
Confidence            777733   99999992   222222222  78999999987  999999999999999999999 99988888888899


Q ss_pred             HhhhhhhhcccCCccccccccccCCCcccccccccccccccccccccCCCCCCCccccccccccCCCCCCCCcccccccc
Q 001070          608 ENREKYLRYQATDPRIGMAAKCAGTSAETCVAEEAQEVDGAGIMETLAQPPCNDEAEVEDSTQDLDGGVSDSTMTTTFAQ  687 (1165)
Q Consensus       608 ~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  687 (1165)
                      |.+|..||+|++.++.+|+|+|+.      .+|+....++..+...+.+    ..++.....+..++|+++++       
T Consensus       773 e~~~~~~~sQa~~~S~~~~rppy~------~t~g~~~~~~S~~~s~~~~----~~a~~~s~S~g~sak~p~~~-------  835 (1283)
T KOG1916|consen  773 EAREPRFCSQASNLSTEMARPPYP------LTEGRDIPGASAAYSQPDD----AGAELGSDSRGFSAKLPAPR-------  835 (1283)
T ss_pred             hhhhhhHHHHhhhhccccCCCCcc------ccccCCCCCcccccCCccc----hhhhhccccCCCcccCCCcc-------
Confidence            999999999999999999999987      5566666666666533333    24556666777777777655       


Q ss_pred             CCCccchhhhcccccccCCCCCCCCccccccccCCCCCCCCCCCCCChhhHHHHHHHHHHHHHHHHHHHHHHHHhhhhcc
Q 001070          688 TGASSAKGKKQKEKKYQASSQCSPSSTVLNLANLSNEPAGSSSLPSAPAAFSQVIAMQDMLNQLMTMQKELQKQMSNLVT  767 (1165)
Q Consensus       688 ~~~~~~~~k~~k~~~~q~~~~~s~~~~~~n~~~s~~e~~~~~~~~~~~~~~~q~~~mq~~l~ql~~~qke~qkqm~~~v~  767 (1165)
                        .| +||||+|++++|.+|.++.+....|.+|++++.....+.|..+ .++|+.++|+.|+|||+-|||||.|+.+-++
T Consensus       836 --l~-ak~~k~kg~~~~spgl~~t~s~~~~lad~~~~qs~qln~p~ed-~~~~l~~qQe~~a~l~~sQ~el~~~l~~ql~  911 (1283)
T KOG1916|consen  836 --LP-AKGKKQKGKNSQSPGLSSTSSNVANLADSFNEQSQQLNHPMED-LLPQLLAQQETMAQLMASQKELQRQLSNQLT  911 (1283)
T ss_pred             --cc-ccccccCCCcCCCCCccccccchHHHHHHHHHHHhhhcCChhh-HHHHHHHHHHHHHHHHHhHHHHHHHHHHhhc
Confidence              44 7999999999999999999999999999999999999976543 3899999999999999999999999999777


Q ss_pred             cchhhhHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-hh
Q 001070          768 LPVTKEGRRLEASLGRGIEKAVKASTDALWARFHEENARNEKLLRDRTQQITGLITNLINKDLTASLEKLVKKELAA-VG  846 (1165)
Q Consensus       768 ~plsKE~kklE~~L~~~ieK~lk~eld~L~~R~dEerr~rEaa~~~RQ~qLL~LVS~~LnktL~~nLEk~LKkeV~s-Vv  846 (1165)
                      .|       ||-.|++.|||.+|.+-|++|+||+|+-+++|++.++.|++|++.+++++.+.+++++||+||+||+. |+
T Consensus       912 g~-------le~~l~~~iEk~lks~~d~~~~rl~e~la~~e~~~r~~~~qi~q~ltq~~s~~~~~~~e~ti~~El~~tv~  984 (1283)
T KOG1916|consen  912 GP-------LEVALGRMIEKSLKSNADALWARLQEELAKNEKALRDLQQQITQQLTQFLSKELNAMFEKTIKKELAKTVG  984 (1283)
T ss_pred             ch-------HHHHHHHHHHHHHHhhHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcc
Confidence            76       99999999999999999999999999999999999999999999999999999999999999999995 99


Q ss_pred             hhhHhhhhhhHHHHHHHHHHHHHhh-cchhhhHHHHHHHHHHHhHHHHHHHHHHhhhhhhhHHHHHHHHHHhHhhcchhH
Q 001070          847 PAIVRTISPSIEKTITSAIVESFQR-GVGDKAVNQLERSVNSRLEATVGRQIQAQFQTSGKHALQDALKSSVEASVIPAF  925 (1165)
Q Consensus       847 PAI~~~t~~avekqlss~l~eslq~-~l~dk~vnqLeK~V~s~Lp~aVaraIq~~vqtsv~qaIqdavr~af~stLIPAF  925 (1165)
                      |+|.+.+.+.+++.+++++.+.++. +++++.++||.|+++  |.++|+|+++.+||+++.  ||++|+++|+++|||+|
T Consensus       985 P~v~rs~~p~~~q~~~s~itkl~~~eg~~kenI~ql~KSkn--l~dtvar~i~~~~Qtsg~--lQ~a~resm~SsviPaf 1060 (1283)
T KOG1916|consen  985 PCVARSVEPVIEQTVSSAITKLFQREGIGKENINQLLKSKN--LEDTVARQIQAQFQTSGP--LQEALRESMESSVIPAF 1060 (1283)
T ss_pred             hhhhhhhHHHHHHHHHHHHHHHHHhhchHHHHHHHHHhhcc--HHHHHHHHHHHHHhccch--HHHHHHHHhhhhccHHH
Confidence            9999999999999999999999999 999999999999998  999999999999999877  99999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcccCCCCCCC
Q 001070          926 EKSCKAMFEQVDATFQKGMVEHTTATLQHFESTHSPLALVLRESVNSVSSMAQTLSGEFVDGQRKLFDLAGVRNNTSAFN 1005 (1165)
Q Consensus       926 E~scq~MFqQV~~~F~rGm~E~~~qlQqq~dSaKtsLv~~L~etIssmaa~q~~LqsEll~lQrQL~~~a~s~qns~as~ 1005 (1165)
                      |++|++||+||+++|+.|+.||++|+...+.+.-                ..+++.+|..+.|..++....+.++.++.+
T Consensus      1061 EKScqaMF~Qi~daF~~Gi~e~~~q~~s~~~s~~----------------qr~a~nrE~~~~ql~~L~~t~~sa~~~~~~ 1124 (1283)
T KOG1916|consen 1061 EKSCQAMFQQIDDAFQKGIQEHTQQLISSASSVP----------------QRQALNRELAEAQLNGLALTAASATEQGSN 1124 (1283)
T ss_pred             HHHHHHHHHHHHHHHHHhHHHHHHHHHHHHhccc----------------hhhhhhhhHHHHHHHHHHHHHHHHhhcCCc
Confidence            9999999999999999999999997754433321                012344455455544443333333333444


Q ss_pred             CCC-CCCCCCCCCCcc-ccccCCCcHHHHHHhhccCcHHHHHHHHHhcCCHHHHHHHhhccCcccccccCCCCcchhHHH
Q 001070         1006 PSV-PLSNGPLLGLHE-KVEATMDPTKELSRLVSDRKYEEAFTTALQRSDVSIVSWLCSQVDMHGLLSMVPLPLSQGVLL 1083 (1165)
Q Consensus      1006 Ps~-Qp~~~P~~as~E-~vEa~lDp~~eI~qLI~eGqyEEAF~kALqSsDlsLV~~LcsrvDP~~Lfsl~PlpLSQgVLL 1083 (1165)
                      |.. +...+|..++=+ +.++..+|+.+|.|||.+|+|||||++||+++|++||.|+|+++|...+|.++||+|+|+|||
T Consensus      1125 pl~~~l~~~~~~~~~~a~~~a~~~P~~~i~~ll~~~~~~~af~~al~~~d~~lv~~~~~~~d~~~~~a~~~~~l~q~vll 1204 (1283)
T KOG1916|consen 1125 PLVTQLSAGPVGALLEAMRSAAMTPTTEISQLLSEGKYNEAFTQALQASDLSLVSWLCSQVDLRQLFAMNPCPLSQGVLL 1204 (1283)
T ss_pred             chHHHHhcchHHHHHHHHHHccCCcHHHHHHHHhcchHHHHHHHHHHhccchhhhHhhhccCHHHhcCCCCCcchHHHHH
Confidence            443 222333322223 456788999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhhcccChHHHHHHHHHHHHHcCCCCchhHHhHHHHHHHHHHHHHhhhcCCCCccccchhHHHHHHHHHHHhhh
Q 001070         1084 SLLQQLACDINKDTARKLAWLTDVAAAINPADPMIAVHARPIFEQVYQRLHHQRSSPTISGAELSSIRLLIHVINSMLMT 1163 (1165)
Q Consensus      1084 SLIQQLSsDL~tdt~lKL~WLEeal~aLDpsDP~IrehvPkIL~~L~qrL~~~~slp~~s~~d~~~lRLl~hvinslL~s 1163 (1165)
                      ||||||+||+.+++.+|++||.+|+.+||++||+||+|+|+|+++||++|++|++.|   +.+.+++|||||+||++|++
T Consensus      1205 sliqqla~d~s~~~~~k~~~~~~~~~ain~sd~~~~~ha~~v~~~~y~~~~~~~~~~---~~~~s~vrlim~~i~s~~~~ 1281 (1283)
T KOG1916|consen 1205 SLIQQLACDISTDTSLKLRYLTEAVLAINPSDPITRVHARPVFEQVYQILHQFRNAP---PSNVSAVRLIMHVINSYLMS 1281 (1283)
T ss_pred             HHHHHHHhhcccchHHHHHHHHHHHHhcCccCchhHhhhhHHHHHHHHHHHHHhcCC---ccchHHHHHHHHHHHHhhcc
Confidence            999999999999999999999999999999999999999999999999999999866   56789999999999999999


Q ss_pred             cC
Q 001070         1164 FK 1165 (1165)
Q Consensus      1164 ~k 1165 (1165)
                      ||
T Consensus      1282 ~k 1283 (1283)
T KOG1916|consen 1282 LK 1283 (1283)
T ss_pred             CC
Confidence            98

>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG0300 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>KOG0269 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0649 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0270 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4328 consensus WD40 protein [Function unknown]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0270 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1188 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown]	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>KOG0269 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0300 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4328 consensus WD40 protein [Function unknown]	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0649 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4547 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG3914 consensus WD repeat protein WDR4 [Function unknown]	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG4227 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>KOG3881 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only]	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1188 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF06705 SF-assemblin: SF-assemblin/beta giardin	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>KOG2695 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown]	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>KOG1310 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1310 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton]	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>COG5178 PRP8 U5 snRNP spliceosome subunit [RNA processing and modification]	Back alignment and domain information

>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG2236 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG3881 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1963 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG4190 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>KOG2675 consensus Adenylate cyclase-associated protein (CAP/Srv2p) [Cytoskeleton; Signal transduction mechanisms]	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>smart00320 WD40 WD40 repeats	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown]	Back alignment and domain information

>KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton]	Back alignment and domain information

>KOG1912 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK15319 AIDA autotransporter-like protein ShdA; Provisional	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>KOG1963 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>KOG1334 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2695 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton]	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>smart00320 WD40 WD40 repeats	Back alignment and domain information

>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription]	Back alignment and domain information

>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		1165
2vxg_A		139	LD41624, GE-1, CG6181-PA, isoform A; decapping, ED	1e-48
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-06
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	3e-04

>2vxg_A LD41624, GE-1, CG6181-PA, isoform A; decapping, EDC4, hedls, mRNA decay, P-BODY, gene regulation; 1.9A {Drosophila melanogaster} Length = 139	Back alignment and structure

 Score =  168 bits (426), Expect = 1e-48
 Identities = 35/136 (25%), Positives = 65/136 (47%), Gaps = 1/136 (0%)

Query: 1030 KELSRLVSDRKYEEAFTTALQRSDVSIVSWLCSQVDMHGLLSMVPLPLSQGVLLSLLQQL 1089
              + +L+   +  +AF  AL  +D+ +V +     D +   +     L Q VLLSL+QQ+
Sbjct: 5    DSIKQLLMAGQINKAFHQALLANDLGLVEFTLRHTDSNQAFAPEGCRLEQKVLLSLIQQI 64

Query: 1090 ACDINKDTARKLAWLTDVAAAINPADPMIAVHARPIFEQVYQRLHHQRSSPTISGAELSS 1149
            + D+      K  +L +   AIN ADP+   HA  +  ++Y+       + +   ++ S+
Sbjct: 65   SADMTNHNELKQRYLNEALLAINMADPITREHAPKVLTELYRNCQQFIKN-SPKNSQFSN 123

Query: 1150 IRLLIHVINSMLMTFK 1165
            +RLL+  I +     K
Sbjct: 124  VRLLMKAIITYRDQLK 139

PyMOL of 2vxg

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		1165
2vxg_A		139	LD41624, GE-1, CG6181-PA, isoform A; decapping, ED	100.0
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	99.44
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	99.43
3ow8_A		321	WD repeat-containing protein 61; structural genomi	99.38
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	99.35
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	99.35
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	99.34
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	99.33
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	99.32
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	99.31
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	99.31
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	99.3
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	99.29
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	99.29
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	99.29
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	99.28
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	99.28
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	99.27
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	99.26
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	99.26
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	99.26
3ow8_A		321	WD repeat-containing protein 61; structural genomi	99.25
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	99.25
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	99.25
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	99.24
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	99.21
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	99.21
2pm7_B		297	Protein transport protein SEC13, protein transport	99.2
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	99.19
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	99.19
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	99.19
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	99.18
2w18_A		356	PALB2, fancn, partner and localizer of BRCA2; fanc	99.18
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	99.17
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	99.16
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	99.16
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	99.16
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	99.16
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	99.16
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	99.16
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	99.15
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	99.15
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	99.15
3jrp_A		379	Fusion protein of protein transport protein SEC13	99.15
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	99.14
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	99.14
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	99.14
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	99.14
3jrp_A		379	Fusion protein of protein transport protein SEC13	99.14
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	99.13
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	99.13
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	99.13
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	99.12
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	99.12
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	99.11
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	99.11
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	99.11
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	99.11
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	99.11
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	99.09
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	99.08
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	99.08
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	99.07
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	99.07
2pm7_B		297	Protein transport protein SEC13, protein transport	99.06
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	99.06
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	99.06
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	99.06
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	99.05
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	99.05
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	99.04
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	99.04
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	99.04
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	99.04
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	99.03
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	99.03
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	99.03
4gq1_A		393	NUP37; propeller, transport protein; 2.40A {Schizo	99.02
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	99.02
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	99.02
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	99.02
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	99.01
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.01
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	99.01
2oaj_A		902	Protein SNI1; WD40 repeat, beta propeller, endocyt	99.01
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	99.01
3vu4_A		355	KMHSV2; beta-propeller fold, protein transport; 2.	99.01
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	99.0
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	99.0
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	98.99
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	98.99
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	98.99
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	98.98
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	98.98
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	98.97
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	98.96
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	98.96
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	98.96
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	98.96
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	98.95
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	98.95
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	98.95
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	98.94
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	98.93
2oaj_A		902	Protein SNI1; WD40 repeat, beta propeller, endocyt	98.93
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	98.92
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	98.92
3vu4_A		355	KMHSV2; beta-propeller fold, protein transport; 2.	98.92
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	98.91
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	98.9
4gq1_A		393	NUP37; propeller, transport protein; 2.40A {Schizo	98.89
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	98.89
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	98.88
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	98.87
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	98.87
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	98.86
2w18_A		356	PALB2, fancn, partner and localizer of BRCA2; fanc	98.86
3jro_A		753	Fusion protein of protein transport protein SEC13	98.84
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	98.84
3jro_A		753	Fusion protein of protein transport protein SEC13	98.81
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	98.8
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	98.77
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	98.76
2oit_A		434	Nucleoporin 214KDA; NH2 terminal domain of NUP214/	98.76
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	98.7
2j04_A		588	TAU60, YPL007P, hypothetical protein YPL007C; beta	98.7
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	98.67
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	98.56
2j04_A		588	TAU60, YPL007P, hypothetical protein YPL007C; beta	98.54
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	98.45
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	98.45
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	98.41
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	98.39
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	98.38
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	98.35
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	98.32
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	98.31
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	98.3
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	98.28
2oit_A		434	Nucleoporin 214KDA; NH2 terminal domain of NUP214/	98.26
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	98.25
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	98.2
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	98.19
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	98.19
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	98.19
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	98.16
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	98.15
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	98.15
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	98.11
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	98.09
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	98.08
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	98.08
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	98.01
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	97.97
1k32_A		1045	Tricorn protease; protein degradation, substrate g	97.89
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	97.86
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	97.81
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	97.81
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	97.8
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	97.78
1k32_A		1045	Tricorn protease; protein degradation, substrate g	97.75
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	97.7
1jof_A		365	Carboxy-CIS,CIS-muconate cyclase; beta-propeller,	97.68
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	97.63
1jof_A		365	Carboxy-CIS,CIS-muconate cyclase; beta-propeller,	97.59
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	97.49
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	97.41
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	97.31
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	97.26
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	97.17
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	97.1
1xip_A		388	Nucleoporin NUP159; beta-propeller, transport prot	97.02
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	97.01
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	96.98
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	96.97
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	96.96
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	96.93
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	96.87
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	96.81
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	96.79
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	96.76
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	96.71
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	96.61
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	96.57
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	96.44
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	96.03
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	95.93
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	95.85
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	95.77
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	95.74
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	95.74
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	95.71
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	95.7
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	95.39
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	95.31
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	95.22
2ece_A		462	462AA long hypothetical selenium-binding protein;	95.02
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	94.99
2qe8_A		343	Uncharacterized protein; structural genomics, join	94.94
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	94.92
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	94.78
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	94.78
2ece_A		462	462AA long hypothetical selenium-binding protein;	94.3
2hz6_A		369	Endoplasmic reticulum to nucleus signalling 1 isof	94.15
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	93.96
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	93.95
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	93.89
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	93.74
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	93.63
2hz6_A		369	Endoplasmic reticulum to nucleus signalling 1 isof	93.31
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	93.13
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	92.99
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	92.6
2qe8_A		343	Uncharacterized protein; structural genomics, join	92.47
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	92.02
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	91.93
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	91.61
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	91.06
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	90.94
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	90.63
3sjl_D		386	Methylamine dehydrogenase heavy chain; MAUG, C-hem	90.5
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	90.36
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	90.02
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	89.28
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	89.08
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	88.17
1xip_A		388	Nucleoporin NUP159; beta-propeller, transport prot	88.14
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	87.84
3v65_B		386	Low-density lipoprotein receptor-related protein;	87.1
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	86.91
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	86.88
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	86.78
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	86.36
4gq2_M		950	Nucleoporin NUP120; beta propeller alpha helical,	86.15
4fhn_B		1139	Nucleoporin NUP120; protein complex,structural pro	85.36
3sjl_D		386	Methylamine dehydrogenase heavy chain; MAUG, C-hem	85.07
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	85.02
3s84_A		273	Apolipoprotein A-IV; four helix bundle, transport	81.57
3sre_A		355	PON1, serum paraoxonase; directed evolution, 6-bla	81.41
1mda_H		368	Methylamine dehydrogenase (heavy subunit); electro	80.94
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	80.4
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	80.35
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	80.04

>2vxg_A LD41624, GE-1, CG6181-PA, isoform A; decapping, EDC4, hedls, mRNA decay, P-BODY, gene regulation; 1.9A {Drosophila melanogaster}	Back alignment and structure

Probab=100.00  E-value=3.1e-36  Score=299.40  Aligned_cols=137  Identities=27%  Similarity=0.415  Sum_probs=121.7

Q ss_pred             CcHHHHHHhhccCcHHHHHHHHHhcCCHHHHHHHhhccCcccccccCCCCcchhHHHHHHHHHhhhcccChHHHHHHHHH
Q 001070         1027 DPTKELSRLVSDRKYEEAFTTALQRSDVSIVSWLCSQVDMHGLLSMVPLPLSQGVLLSLLQQLACDINKDTARKLAWLTD 1106 (1165)
Q Consensus      1027 Dp~~eI~qLI~eGqyEEAF~kALqSsDlsLV~~LcsrvDP~~Lfsl~PlpLSQgVLLSLIQQLSsDL~tdt~lKL~WLEe 1106 (1165)
                      |+.++|.+||++|+|||||++||+++|+++|+|+|+++||++||+..|++|||+|||||+||||+||++++++||+|||+
T Consensus         2 ~~~~~I~~Ll~~g~~eeAf~~aL~ssd~~lv~~lc~~~dp~~~~~~~~~~Lsq~vLLSLiqqls~dL~~~~~~Kl~WLe~   81 (139)
T 2vxg_A            2 AMGDSIKQLLMAGQINKAFHQALLANDLGLVEFTLRHTDSNQAFAPEGCRLEQKVLLSLIQQISADMTNHNELKQRYLNE   81 (139)
T ss_dssp             HHHHHHHHHHHHTCHHHHHHHHHHTTCHHHHHHHHHHSCHHHHTC----CCCHHHHHHHHHHHHHCCTTCCHHHHHHHHH
T ss_pred             cHHHHHHHHHHCCCHHHHHHHHHHhCcHHHHHHHHHcCCHHHhcCCCCCCccHHHHHHHHHHHHHHhccCcHHHHHHHHH
Confidence            45788999999999999999999999999999999999999999988999999999999999999999999999999999


Q ss_pred             HHHHcCCCCchhHHhHHHHHHHHHHHHHhhh-cCCCCccccchhHHHHHHHHHHHhhhcC
Q 001070         1107 VAAAINPADPMIAVHARPIFEQVYQRLHHQR-SSPTISGAELSSIRLLIHVINSMLMTFK 1165 (1165)
Q Consensus      1107 al~aLDpsDP~IrehvPkIL~~L~qrL~~~~-slp~~s~~d~~~lRLl~hvinslL~s~k 1165 (1165)
                      |+++||++||+||+|+|+||++|++||++++ +.|.  ....++||+|+|+||+|++..|
T Consensus        82 vl~aid~~dp~i~~~~p~Il~~l~~~L~~~~~~~p~--~~~~~~i~~l~~~~~~l~~~~~  139 (139)
T 2vxg_A           82 ALLAINMADPITREHAPKVLTELYRNCQQFIKNSPK--NSQFSNVRLLMKAIITYRDQLK  139 (139)
T ss_dssp             HHHHCCTTSHHHHHHHHHHHHHHHHHHHHHHHHCTT--STTHHHHHHHHHHHHHHC----
T ss_pred             HHHHcCCCCchHHHHHHHHHHHHHHHHHHHHhcCCC--ChHHhHHHHHHHHHHHHHHhhC
Confidence            9999999999999999999999999999854 4443  3666999999999999998765

PyMOL of 2vxg

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens}	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C*	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens}	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens}	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ...	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C*	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B	Back alignment and structure

>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-}	Back alignment and structure

>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ...	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens}	Back alignment and structure

>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A*	Back alignment and structure

>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		1165
d1jvra_		137	a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell	0.002

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		1165
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	99.41
d1tbga_		340	beta1-subunit of the signal-transducing G protein	99.33
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	99.23
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	99.22
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	99.21
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	99.19
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	99.13
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	99.11
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	99.09
d1tbga_		340	beta1-subunit of the signal-transducing G protein	99.08
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	99.03
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	99.0
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	98.99
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	98.96
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	98.96
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	98.95
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	98.94
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	98.87
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	98.85
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	98.8
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	98.78
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	98.77
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	98.76
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	98.71
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	98.64
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	98.63
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	98.54
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	98.54
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	98.52
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	98.51
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	98.47
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	98.46
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	98.35
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	98.34
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	98.34
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	98.3
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	98.21
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	98.19
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	98.03
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	97.84
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	97.71
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	97.71
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	97.66
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	97.63
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	97.52
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	97.41
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	97.24
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	96.8
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	96.25
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	95.65
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	95.15
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	93.93
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	93.62
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	92.13
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	90.73
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	90.35
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	86.73
d1v04a_		340	Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory	82.26
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	82.01
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	80.2

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Actin interacting protein 1
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]

Probab=99.41  E-value=1.8e-12  Score=136.13  Aligned_cols=127  Identities=14%  Similarity=0.173  Sum_probs=103.2

Q ss_pred             eeecCceEEEeecCCcEEEEeCcch---hhHhhcCCcc------------------------EEEeecCCCceeEEecCC
Q 001070          153 IAVNKHYVCYGLKGGNVRVLNLNTA---TRSLLRGHTK------------------------IKIWEDSKVAPLIILKPH  205 (1165)
Q Consensus       153 IAVn~~yIayG~kdg~IRVwdi~t~---ir~llrGH~q------------------------VriWD~~~g~pl~~leph  205 (1165)
                      ++.||+|||+|..||.|||||+.+.   .+..|.+|+.                        ++|||..++.++..++.|
T Consensus        66 ~sp~g~~latg~~dg~i~iwd~~~~~~~~~~~~~~~~~~v~~v~~s~d~~~l~~~~~~~~~~~~v~~~~~~~~~~~l~~h  145 (311)
T d1nr0a1          66 TSPSGYYCASGDVHGNVRIWDTTQTTHILKTTIPVFSGPVKDISWDSESKRIAAVGEGRERFGHVFLFDTGTSNGNLTGQ  145 (311)
T ss_dssp             ECTTSSEEEEEETTSEEEEEESSSTTCCEEEEEECSSSCEEEEEECTTSCEEEEEECCSSCSEEEEETTTCCBCBCCCCC
T ss_pred             EeCCCCeEeccccCceEeeeeeeccccccccccccccCcccccccccccccccccccccccccccccccccccccccccc
Confidence            5568999999999999999999982   3457899987                        789999999999999988


Q ss_pred             CCCCcceeEeecCCCCCCceEEEeecCCCceEEEeEccCcCCCCCCCCCCCcceEEEEeccCCCCCccccccEEEEEeec
Q 001070          206 GGQPVNSAQYLTAPNQAGHIILVTAGPLNREVKLWASASEEGWSLPTHAESWKCTQTLDLKSSAKPRVEEAFFNQVVVLS  285 (1165)
Q Consensus       206 dG~sV~SVaFl~aP~~~d~~~lvtsGslnrtIKLW~~a~~~~~~~~~~~~~w~C~QTLe~~~s~~~~~~~aff~sV~~~p  285 (1165)
                      . +.|++|+|  .|++..   ++++|+.|++|+|||+.            .++|..++..        |...++.|..+|
T Consensus       146 ~-~~v~~v~~--~~~~~~---~l~sgs~d~~i~i~d~~------------~~~~~~~~~~--------~~~~i~~v~~~p  199 (311)
T d1nr0a1         146 A-RAMNSVDF--KPSRPF---RIISGSDDNTVAIFEGP------------PFKFKSTFGE--------HTKFVHSVRYNP  199 (311)
T ss_dssp             S-SCEEEEEE--CSSSSC---EEEEEETTSCEEEEETT------------TBEEEEEECC--------CSSCEEEEEECT
T ss_pred             c-cccccccc--ccccee---eeccccccccccccccc------------cccccccccc--------ccccccccccCc
Confidence            5 48999999  466544   67789999999999974            3488888873        677889999999


Q ss_pred             CCcEEEEeccCCCcEEEEEee
Q 001070          286 QAGLLLFANAKKNAIYSVHLG  306 (1165)
Q Consensus       286 ~a~~ilLan~~r~aIYalhl~  306 (1165)
                      ++.+|+.+... ..|+..++.
T Consensus       200 ~~~~l~~~~~d-~~v~~~d~~  219 (311)
T d1nr0a1         200 DGSLFASTGGD-GTIVLYNGV  219 (311)
T ss_dssp             TSSEEEEEETT-SCEEEEETT
T ss_pred             ccccccccccc-ccccccccc
Confidence            99988877654 455655544

PyMOL of d1nr0a1

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure