Citrus Sinensis ID: 001090

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------116
MSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDWEPENEVQSDDNDSEYNVAEEYSTEEKGSLSSTSSGDSECSAEDSEDGENPMDGLRRSKRKKQKAEVEIMTSSGRRVKRRILDESEGNAAFGNKRTRKSGNRQKSSRRKSSTSKSLRPQRAAARNARSFFSKITGASTDGEDVDGSEGELSESESDLQDSYIESEESGRSLLNEQRKHSKGKGISLDDSEDVTKLDTPESHVNAGIRRLVLKLPVRDSNKHELQERTSDKCNQLVSVIGTSSEAHQEATEGNGNRVSYVGNNCSSVDANCGLMERRGRGQFDKLEDYLNLSNGYKDGKIRWGGVRARSSKRLKIGEMMPLDANNGSGIHLDDDKEKESEVNGHVKPEKDGIDISCGEEITNCGDNTDEVPLKNVKNLSGENNDVYSGDASCKEQQSGFSELNYYDESKCVNTTDEDTTPYPNHLQNGTIQPSELKEILTPVSTKLRIRSKRILRDADVENQNNGCDALHGSSLDIKPNSLPEVLESDGTNRTSSDRGADGSQRLNAQIDSTSEHDPLGSHSHSHDPLGSHSHSHSRKMFNVVYRRSKTNRDRTNSEGDGGGVGESTLNANNNNFHESATDGSRRTRSMGLKTTTCDPDNVSSNLRLEQHNQPEDMYSGHNRSTSRCQLPHEEWGSSSKMTVGLRSTRNRRTSYLFCDSSPIDRRKTHQSLRKGSWLMLSTHEEGSRYIPQLGDEVVYLRQGHQEYINYSGSREVGPWITVKGNIRAVEFCKVESLEYATASGSGDSCCKMTLKFIDPTSSVSNMTFRLTLPEVTGFPDFLVERTRFDAAIQRNWTCRDKCKVWWKNESDEDGSWWDGRVLSVKPKSSEFPDSPWERYTVQYKTEPTETHLHSPWELFDSDTQWEQPRIDDDNRNKLLSAFAKLEQSANRVQDQYGVQKLKQVSQKTNFTNRFPVPLSLDVIQSRLENNYYRGLEAVKHDIAVMLSNAESYFGRNTDLSTKIKRLSDLVTRTLSSLKAPQFHDVGQ
ccccccccEEEEEccccEEEEEEEcccEEEEEEEEcccccEEEEEcccccEEEEEcccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccEEEEEHHHHHHHHHHHccccccccccccccccccEEEEEEEEEEEEccccccEEEEEEEEEEcccccccccEEEEEcccccccccEEEEHHHHHHHHHccccccccEEEEccccccccccEEEEEEEEEcccccccccccccEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccccc
ccccccccEEEEEcccccEEEEEcccccEEEEcEEcccccEEEEEccccEEEEEEccccccHccccHHHHEcccccHHHHcccccEccHHHcccccccccccccEcccccccccHHHHHcccccccccccEEccccEEEEEcccccccccccccccccHHHHHccccHHHHHHcccccccEEcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccEEEEccccEEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHccccccccccEcccccccccccccccccccccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccEcccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcEcccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccEcccccccccccccccEEccccccccccccccccccccccccHcccccccccccccccccccccccccccccHHccccHHccccccHEEccccccccccccccccEEEEEEcccHHHEEEcccccccccccccccccccEEEEEEEEEEEEcccccccEEEEEEEEEcccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccEEEEEEEcccccccccccccEEEEEEEEcccccccccccccccccccccccccccHHHHHHHccccccccccccccHHHccHHHHHcHcHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHcc
msagydgktIVWDIWEGIPIRIYEisrfrlvdgkfspdgasiilsddvgqlyilntgqgesqkdakydqfflgdyrplvqdtygnvldqetqlaphrrnlqdplcdsamipypepyqTMYQQRRLGAlgiewrpsslklavgpdfsldqgyqlqpladldvmidplpefidvmdwepenevqsddndseynvaeeysteekgslsstssgdsecsaedsedgenpmdglrrskrkKQKAEVEIMTSSGRRVKRRIldesegnaafgnkrtrksgnrqkssrrksstskslrpQRAAARNARSFFSkitgastdgedvdgsegelsesesdlqdsyiesEESGRSLLNEQRkhskgkgislddsedvtkldtpeshvnAGIRRLVLklpvrdsnkhelqertsdkCNQLVSVIGtsseahqeategngnrvsyvgnncssvdancglmerrgrgqfdklEDYLNlsngykdgkirwggvrarsskrlkigemmpldanngsgihldddkekesevnghvkpekdgidiscgeeitncgdntdevplknvknlsgenndvysgdasckeqqsgfselnyydeskcvnttdedttpypnhlqngtiqpselkeiltpvstklrirskrilrdadvenqnngcdalhgssldikpnslpevlesdgtnrtssdrgadgsqrlnaqidstsehdplgshshshdplgshshshsRKMFNVVYRRsktnrdrtnsegdgggvgestlnannnnfhesatdgsrrtrsmglktttcdpdnvssnlrleqhnqpedmysghnrstsrcqlpheewgssskmtvglrstrnrrtsylfcdsspidrrkthqslrkGSWLMLstheegsryipqlgDEVVYLRQGHqeyinysgsrevgpwitvkgniraveFCKVESLEyatasgsgdscckmtlkfidptssvsnmtfrltlpevtgfpdflVERTRFDAAIQRNWTCRDKCKVWwknesdedgswwdgrvlsvkpkssefpdspwerytvqykteptethlhspwelfdsdtqweqpridddnRNKLLSAFAKLEQSANRVQDQYGVQKLKQVSqktnftnrfpvplSLDVIQSRLENNYYRGLEAVKHDIAVMLSNaesyfgrntdlSTKIKRLSDLVTRTlsslkapqfhdvgq
msagydgktivwdiwegiPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNtgqgesqkdAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDWEPEnevqsddndseyNVAEEysteekgslsstssgdsecsaedsedgenpmdglrrskrkkqkaeveimtssgrrvkrrildesegnaafgnkrtrksgnrqkssrrksstskslrpqraaarnarsffskitgastdgedvdgsegelsesesdlqdsYIESEESGRSLLneqrkhskgkgislddsedvtkldtpeshvnagirrlvlklpvRDSNKhelqertsdkcnqLVSVIGTSseahqeategngnrvsyVGNNCSSVDANCGLMERRGRGQFDKLEDYLNLsngykdgkirwggvrarsskrlkigemmpldanngsgiHLDDDKEKesevnghvkpekdgidisCGEEITNCGDNTDEVPLKNVKNLSGENNDVYSGDASCKEQQSGFSELNYYDESKCVNTTDEDTTPYPNHlqngtiqpselkeiltpvstklrirskrilrdadvenqnngcdalhgssldikpnSLPEVLEsdgtnrtssdrgadgsqRLNAQIDSTSEHDPLGSHSHSHDPLGSHSHSHSRKMFNVVYRRsktnrdrtnsegdgggvgestlnannnnfhesatdgsrrtrSMGLktttcdpdnvssnLRLEQHNQPEDMYSGHNRSTSRCQlpheewgssskmtvglrstrnrrtsylfcdsspidrrkthqslrkgsWLMLSTHEEGSRYIPQLGDEVVYLRQGHQEYInysgsrevgpWITVKGNIRAVEFCKVESLEYATasgsgdsccKMTLKFIDPTSSVSNMTFRLTLPEVTGFPDFLVERTRfdaaiqrnwtcrdkckvwwknesdedgswwdgrvlsvkpkssefpdspweRYTVQYKTEptethlhspwelFDSDTQWEQPRIDDDNRNKLLSAFAKLEQSANRVQDQYGVQKLKqvsqktnftnrfpvplSLDVIQSRLENNYYRGLEAVKHDIAVMLSNAESYFGRNTDLSTKIKRLSDLVTRtlsslkapqfhdvgq
MSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDWEPENEVQSDDNDSEYNVAEEYsteekgslsstssgdsecsaeDSEDGENPMDGLRRSKRKKQKAEVEIMTSSGRRVKRRILDESEGNAAFGNKRTrksgnrqkssrrksstsksLRPQraaarnarSFFSKITGASTdgedvdgsegelsesesdlqdsYIESEESGRSLLNEQRKHSKGKGISLDDSEDVTKLDTPESHVNAGIRRLVLKLPVRDSNKHELQERTSDKCNQLVSVIGTSSEAHQEATEGNGNRVSYVGNNCSSVDANCGLMERRGRGQFDKLEDYLNLSNGYKDGKIRWGGVRARSSKRLKIGEMMPLDANNGSGIHLDDDKEKESEVNGHVKPEKDGIDISCGEEITNCGDNTDEVPLKNVKNLSGENNDVYSGDASCKEQQSGFSELNYYDESKCVNTTDEDTTPYPNHLQNGTIQPSELKEILTPVSTKLRIRSKRILRDADVENQNNGCDALHGSSLDIKPNSLPEVLESDGTNRTSSDRGADGSQRLNAQIDSTSEHDPLGSHSHSHDPLGSHSHSHSRKMFNVVYRRSKTNRDRTNSEGDGGGVGESTLNANNNNFHESATDGSRRTRSMGLKTTTCDPDNVSSNLRLEQHNQPEDMYSGHNRSTSRCQLPHEEWGSSSKMTVGLRSTRNRRTSYLFCDSSPIDRRKTHQSLRKGSWLMLSTHEEGSRYIPQLGDEVVYLRQGHQEYINYSGSREVGPWITVKGNIRAVEFCKVESLEYATASGSGDSCCKMTLKFIDPTSSVSNMTFRLTLPEVTGFPDFLVERTRFDAAIQRNWTCRDKCKVWWKNESDEDGSWWDGRVLSVKPKSSEFPDSPWERYTVQYKTEPTETHLHSPWELFDSDTQWEQPRIDDDNRNKLLSAFAKLEQSANRVQDQYGVQKLKQVSQKTNFTNRFPVPLSLDVIQSRLENNYYRGLEAVKHDIAVMLSNAESYFGRNTDLSTKIKRLSDLVTRTLSSLKAPQFHDVGQ
*****DGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDW***********************************************************************************************************************************************************************************************************GIRRLVLKL******************************************VSYVGNNCSSVDANCGLMERRGRGQFDKLEDYLNLSNGYKDGKIRWGGVR*************************************************C***I*******************************************YY********************************************************************************************************************************************************************************************************************************************************YLFC****************GSWLMLSTHEEGSRYIPQLGDEVVYLRQGHQEYINYSGSREVGPWITVKGNIRAVEFCKVESLEYATASGSGDSCCKMTLKFIDPTSSVSNMTFRLTLPEVTGFPDFLVERTRFDAAIQRNWTCRDKCKVWWKNESDEDGSWWDGRVLSV***********WERYTVQYK*******LHSPWELF************************************YGVQKLKQVSQKTNFTNRFPVPLSLDVIQSRLENNYYRGLEAVKHDIAVMLSNAESYFGRNTDLSTKIKRLSDLVT****************
MSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPY**************EWRPSSLKLA****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************HQSLRKGSWLMLSTHEEGSRYIPQLGDEVVYLRQGHQEYINYSGSREVGPWITVKGNIRAVEFCKVESLEYATASGSGDSCCKMTLKFIDPTSSVSNMTFRLTLPEVTGFPDFLVERTRFDAAIQRNWTCRDKCKVWWKNESDEDGSWWDGRVLSVKPKSSEFPDSPWERYTVQYKTEPTETHLHSPWELFDSDTQW******DDNRNKLLSAFAKLEQSANRVQDQYGVQKLKQVSQKTNFTNRFPVPLSLDVIQSRLENNYYRGLEAVKHDIAVMLSNAESYFGRNTDLSTKIKRLSDLVTRTLSSLKAPQFHD***
MSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDWEPENEVQSDDNDSEYN********************************************************GRRVKRRILDESEGNAAF**********************************ARSFFSKITGAS********************************SLLN************LDDSEDVTKLDTPESHVNAGIRRLVLKLPVRDSNKHELQERTSDKCNQLVSVIGT***********NGNRVSYVGNNCSSVDANCGLMERRGRGQFDKLEDYLNLSNGYKDGKIRWGGVRARSSKRLKIGEMMPLDANNGSGIHLDD**********HVKPEKDGIDISCGEEITNCGDNTDEVPLKNVKNLSGENNDVYSGDASCKEQQSGFSELNYYDESKCVNTTDEDTTPYPNHLQNGTIQPSELKEILTPVSTKLRIRSKRILRDADVENQNNGCDALHGSSLDIKPNSLPEVLE***************SQRLNAQIDST************************RKMFNVVYRRSKT***********GGVGESTLNANNNNFHES*********SMGLKTTTCDPDNVSSNLRLEQHNQPEDMYSGHNRSTSRCQLPHEEWGSSSKMTVGLRSTRNRRTSYLFCDSSPIDRRKTHQSLRKGSWLMLSTHEEGSRYIPQLGDEVVYLRQGHQEYINYSGSREVGPWITVKGNIRAVEFCKVESLEYATASGSGDSCCKMTLKFIDPTSSVSNMTFRLTLPEVTGFPDFLVERTRFDAAIQRNWTCRDKCKVWWKNESDEDGSWWDGRVLSVKPKSSEFPDSPWERYTVQYKTEPTETHLHSPWELFDSDTQWEQPRIDDDNRNKLLSAFAKLEQSANRVQDQYGVQKLKQVSQKTNFTNRFPVPLSLDVIQSRLENNYYRGLEAVKHDIAVMLSNAESYFGRNTDLSTKIKRLSDLVTRTLSSLKAPQFHDVGQ
***GYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDWEPENEVQSDDNDSE***************************************************VEIMTSSGRRVKRRILD*********************************************************************************************************S*DVTKLDTPESHVNAGIRRLVLKLPVRDSNK*************************************************************DKLEDYLNLSNGYKDGKIRWGGVRARSSKRL****************************************ISC*EEITNCGDNTDEVPLKNVKNLSGENNDVYSG************************************************EILTPVSTKLRIRSKRILRDADV**************LDIKPNSLPEVLE***************************************************KMFN***RRS**********************************************************************************************************************KTHQSLRKGSWLMLSTHEEGSRYIPQLGDEVVYLRQGHQEYINYSGSREVGPWITVKGNIRAVEFCKVESLEYATASGSGDSCCKMTLKFIDPTSSVSNMTFRLTLPEVTGFPDFLVERTRFDAAIQRNWTCRDKCKVWWKNESDEDGSWWDGRVLSVKPKSSEFPDSPWERYTVQYKTEPTETHLHSPWELFDSDTQWEQPRIDDDNRNKLLSAFAKLEQSANRVQDQYGVQKLKQVSQKTNFTNRFPVPLSLDVIQSRLENNYYRGLEAVKHDIAVMLSNAESYFGRNTDLSTKIKRLSDLVTRTLSSLKAPQFH****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDWEPENEVQSDDNDSEYNVAEEYSTEEKGSLSSTSSGDSECSAEDSEDGENPMDGLRRSKRKKQKAEVEIMTSSGRRVKRRILDESEGNAAFGNKRTRKSGNRQKSSRRKSSTSKSLRPQRAAARNARSFFSKITGASTDGEDVDGSEGELSESESDLQDSYIESEESGRSLLNEQRKHSKGKGISLDDSEDVTKLDTPESHVNAGIRRLVLKLPVRDSNKHELQERTSDKCNQLVSVIGTSSEAHQEATEGNGNRVSYVGNNCSSVDANCGLMERRGRGQFDKLEDYLNLSNGYKDGKIRWGGVRARSSKRLKIGEMMPLDANNGSGIHLDDDKEKESEVNGHVKPEKDGIDISCGEEITNCGDNTDEVPLKNVKNLSGENNDVYSGDASCKEQQSGFSELNYYDESKCVNTTDEDTTPYPNHLQNGTIQPSELKEILTPVSTKLRIRSKRILRDADVENQNNGCDALHGSSLDIKPNSLPEVLESDGTNRTSSDRGADGSQRLNAQIDSTSEHDPLGSHSHSHDPLGSHSHSHSRKMFNVVYRRSKTNRDRTNSEGDGGGVGESTLNANNNNFHESATDGSRRTRSMGLKTTTCDPDNVSSNLRLEQHNQPEDMYSGHNRSTSRCQLPHEEWGSSSKMTVGLRSTRNRRTSYLFCDSSPIDRRKTHQSLRKGSWLMLSTHEEGSRYIPQLGDEVVYLRQGHQEYINYSGSREVGPWITVKGNIRAVEFCKVESLEYATASGSGDSCCKMTLKFIDPTSSVSNMTFRLTLPEVTGFPDFLVERTRFDAAIQRNWTCRDKCKVWWKNESDEDGSWWDGRVLSVKPKSSEFPDSPWERYTVQYKTEPTETHLHSPWELFDSDTQWEQPRIDDDNxxxxxxxxxxxxxxxxxxxxxYGVQKLKQVSQKTNFTNRFPVPLSLDVIQSRLENNYYRGLEAVKHDIAVMLSNAESYFGRNTDLSTKIKRLSDLVTRTLSSLKAPQFHDVGQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1159 2.2.26 [Sep-21-2011]
Q921C3 2304 Bromodomain and WD repeat yes no 0.244 0.122 0.280 9e-23
A2AHJ4 1799 Bromodomain and WD repeat no no 0.242 0.156 0.260 2e-22
Q6RI45 1802 Bromodomain and WD repeat yes no 0.240 0.154 0.259 3e-22
Q9NSI6 2320 Bromodomain and WD repeat no no 0.237 0.118 0.278 5e-22
Q8VDD9 1821 PH-interacting protein OS no no 0.231 0.147 0.263 8e-20
Q8WWQ0 1821 PH-interacting protein OS no no 0.230 0.146 0.256 1e-19
Q54MP8 2200 Bromodomain and WD repeat yes no 0.099 0.052 0.354 2e-14
>sp|Q921C3|BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 Back     alignment and function desciption
 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 93/331 (28%), Positives = 152/331 (45%), Gaps = 48/331 (14%)

Query: 849  WLMLSTHEEGSRYIPQLGDEVVYLRQGHQEYIN-------YSGSREVGPWITVKGNIRAV 901
            W+  +T  + S ++PQ+GDEV+Y RQGH+ YI        Y  +    PW   K ++R  
Sbjct: 947  WITDTTLRK-SPFVPQMGDEVMYFRQGHEAYIEAVRRNNIYELNPHKEPW--RKMDLRDQ 1003

Query: 902  EFCKVESLEYATASGSGDSCCKMTLKFIDP-TSSVSNMTFRLTLPEVTGFPDFLVERTRF 960
            E  K+  L Y    G    CC + L FIDP T  +++ +F +   ++    DFLV R  +
Sbjct: 1004 ELVKIVGLRYEV--GPPTLCC-LKLAFIDPATGRLTDKSFSIRYHDMPDVIDFLVLRQFY 1060

Query: 961  DAAIQRNWTCRDKCKVWWKNESDEDGSWWDGRVLSVKPKSSEFPDSPWERYTVQYKTEPT 1020
            D A QRNW   D+ +      S  D +WW G VLS +P   ++PDS ++ Y V++    T
Sbjct: 1061 DEARQRNWQPCDRFR------SIIDDAWWFGTVLSQEPYQPQYPDSHFQCYIVRWDN--T 1112

Query: 1021 ETHLHSPWELFDSDTQWEQPR-------IDDDNRNKLLSAFAKLEQSANRVQDQ------ 1067
            ET   SPW++       + P        +  D   KLL    + E    R +D+      
Sbjct: 1113 ETEKLSPWDMEPIPDNVDPPEELGASISVTSDELEKLLYKPQEGEW-GQRSRDEECDRII 1171

Query: 1068 YGVQKLKQVSQKTNFTN-----RFP-------VPLSLDVIQSRLENNYYRGLEAVKHDIA 1115
             G+ +L  +     F        +P        P  L  I+ RL N +YR L A+  ++ 
Sbjct: 1172 SGIDQLLNLDIAAAFAGPVDLCTYPKYCTVVAYPTDLYTIRMRLVNRFYRRLSALIWEVR 1231

Query: 1116 VMLSNAESYFGRNTDLSTKIKRLSDLVTRTL 1146
             +  NA ++    + ++   K+++D + + +
Sbjct: 1232 YIEHNARTFNEPESVIARSAKKITDQLLKFI 1262
May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape.
Mus musculus (taxid: 10090)
>sp|A2AHJ4|BRWD3_MOUSE Bromodomain and WD repeat-containing protein 3 OS=Mus musculus GN=Brwd3 PE=2 SV=1 Back     alignment and function description
>sp|Q6RI45|BRWD3_HUMAN Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens GN=BRWD3 PE=1 SV=2 Back     alignment and function description
>sp|Q9NSI6|BRWD1_HUMAN Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 Back     alignment and function description
>sp|Q8VDD9|PHIP_MOUSE PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 Back     alignment and function description
>sp|Q8WWQ0|PHIP_HUMAN PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 Back     alignment and function description
>sp|Q54MP8|Y5837_DICDI Bromodomain and WD repeat-containing DDB_G0285837 OS=Dictyostelium discoideum GN=DDB_G0285837 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1159
225431924 1756 PREDICTED: uncharacterized protein LOC10 0.970 0.640 0.636 0.0
356558137 1773 PREDICTED: uncharacterized protein LOC10 0.956 0.625 0.532 0.0
356532519 1777 PREDICTED: uncharacterized protein LOC10 0.963 0.628 0.543 0.0
449433431 1729 PREDICTED: uncharacterized protein LOC10 0.949 0.636 0.515 0.0
124359647 1826 Cytochrome cd1-nitrite reductase-like, C 0.965 0.612 0.521 0.0
357449001 1844 Bromodomain and WD repeat-containing pro 0.965 0.606 0.521 0.0
449517975 1382 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.949 0.796 0.511 0.0
225437555 1766 PREDICTED: uncharacterized protein LOC10 0.955 0.626 0.526 0.0
9759426 1576 WD-40 repeat protein-like [Arabidopsis t 0.904 0.664 0.505 0.0
297795697 1662 transducin family protein [Arabidopsis l 0.903 0.629 0.504 0.0
>gi|225431924|ref|XP_002277060.1| PREDICTED: uncharacterized protein LOC100248159 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1317 bits (3408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 748/1176 (63%), Positives = 881/1176 (74%), Gaps = 51/1176 (4%)

Query: 1    MSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGE 60
            MSAGYDGKTIVWDIWEG PIRIY+ +RF+LVDGKFSPDG SIILSDDVGQLYIL+TGQGE
Sbjct: 605  MSAGYDGKTIVWDIWEGTPIRIYDTARFKLVDGKFSPDGTSIILSDDVGQLYILSTGQGE 664

Query: 61   SQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMY 120
            SQKDA YDQFFLGDYRPL+QDTYGNVLDQETQLAP+RRN+QD LCD+ MIPYPEPYQ+MY
Sbjct: 665  SQKDAMYDQFFLGDYRPLIQDTYGNVLDQETQLAPYRRNMQDLLCDATMIPYPEPYQSMY 724

Query: 121  QQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDWEPENE 180
            QQRRLGALGIEWRPSSL+LAVGPDF+LDQ YQ+ PL DLDV+IDPLPEFIDVMDWEPENE
Sbjct: 725  QQRRLGALGIEWRPSSLRLAVGPDFNLDQDYQMLPLPDLDVLIDPLPEFIDVMDWEPENE 784

Query: 181  VQSDDNDSEYNVAEEYSTE-EKGSLSSTSSGDSECSAEDSEDGENPMDGLRRSKRKKQKA 239
            VQ+DD DSEYNV EEYST  E+GSLSS SSGD ECSAEDS+   +  DGLRRSKRKKQKA
Sbjct: 785  VQTDDTDSEYNVTEEYSTGGEQGSLSSNSSGDPECSAEDSDVENSHKDGLRRSKRKKQKA 844

Query: 240  EVEIMTSSGRRVKRRILDESEGNAAFGNKRTRKSGNRQKSSRRKSSTSKSLRPQRAAARN 299
            E EIMT SGRRVKRR LDE +GN+   N RTRKS + +K S + SS SKSLRPQRAAARN
Sbjct: 845  ETEIMTFSGRRVKRRNLDEFDGNSLRSN-RTRKSRSGRKVSHKNSSKSKSLRPQRAAARN 903

Query: 300  ARSFFSKITGASTDGEDVDGSEGELSESESDLQDSYIESEESGRSLLNEQRKHSKGKGIS 359
            A + FS++ G STDGED DGSEG+LSESES L+DS IES+ES  SL NEQ KHSKGK +S
Sbjct: 904  ALTLFSRMKGTSTDGEDEDGSEGDLSESESSLEDSNIESDESDGSLQNEQCKHSKGKEVS 963

Query: 360  LDDSEDVTKL-DTPESHVNAG-IRRLVLKLPVRDSNKHELQERTSDKCNQLVSVIGTSSE 417
            LD+ ED+ K  + PES +NAG  RRLVLK P+RDSN+  L        NQ   ++G+SS+
Sbjct: 964  LDEFEDMDKQHEHPESCMNAGNRRRLVLKFPIRDSNRLLLAPE-----NQ-ADLVGSSSK 1017

Query: 418  AHQEATEGNGNRVSYVGNNCSSVDANCGLMERRGRGQFDKLEDYLNLSNGYKDGKIRWGG 477
            A QEA+E N N +S      SS DANC  +ERR RGQ +K+ED+L+L  GYKDGKIRWGG
Sbjct: 1018 APQEASEVNRNHLSSQDLGYSSSDANCNRIERRERGQPEKIEDHLDLFEGYKDGKIRWGG 1077

Query: 478  VRARSSKRLKIGEMMPLDANNGSGIHLDDDKEKESEVNGHVKPEKDGIDISCGEEITNCG 537
            V+AR+SKRL++ E MP D +  S   +D     E+ +NG  +PEK+   IS   EI    
Sbjct: 1078 VKARTSKRLRVVEPMPSDTDARSRQCIDGHDATENTINGFQEPEKNYDRISPHSEIKYHV 1137

Query: 538  DNTDEVPLKNVKNLSGENNDVYSGDASCK-EQQSGFSELNYYDES-KCVNTTDEDTTPYP 595
            + T ++   N ++    N  V   DA+   ++ S F+E   YDE  K VN    DT    
Sbjct: 1138 EETGKMAHMNGQHFG--NGAVEGLDATSNGKKHSSFNECMNYDEPPKQVNMVAGDTAASS 1195

Query: 596  NHLQNGTIQPSELKEILTPVSTKLRIRSKRILRDAD----------VENQNNG-CDALHG 644
                NGT  P  LKE  T  STKLRIRSK+IL D +          VE+ +NG CD L  
Sbjct: 1196 VQHSNGTDHPPHLKESSTS-STKLRIRSKKILEDPEIPSDPKIKSSVEDWSNGRCDTLSE 1254

Query: 645  SSLDIKPNSLPEVLESDGTNRTSSDRG-ADGSQRLNAQIDSTSEHDPLGSHSHSHDPLGS 703
            S L+I      EV + D T+R  SD G  +G  +  A I+  S        S   D  G 
Sbjct: 1255 SQLEIA-----EVPDCDDTDRPHSDHGDWNGLLKSEAAIEQNSR-------SVLQDSQGL 1302

Query: 704  HSHSHSRKMFNVVYRRSKTNRDRTNSEGDGGGVGESTLNANNNN------FHESATDGSR 757
            +SH ++ KM+N VYRRS++ R RTNSEG+GGG+ EST NA+N+N      FHE+ TDG+R
Sbjct: 1303 YSHVNN-KMYNAVYRRSRSYRTRTNSEGEGGGMEESTSNASNHNLDSGMDFHEATTDGAR 1361

Query: 758  RTRSMGLKTTTCDPDNVSSNLRLEQHNQPEDMYSGHNR-STSRC-QLPHEEWGSSSKMTV 815
            RTRSMGLK TT DPD   SNL+L   +  ED     ++ S +R  +LP EEW SSS+MTV
Sbjct: 1362 RTRSMGLKATTRDPDVTCSNLKLRLGHGSEDTLKSVDKFSVNRSDELPCEEWMSSSRMTV 1421

Query: 816  GLRSTRNRRTSYLFCDSSP--IDRRKTHQSLRKGSWLMLSTHEEGSRYIPQLGDEVVYLR 873
            GLRS RNRR SY   D+SP  ++RRK HQS +K SWLMLS H E  RYIPQLGDEVVYLR
Sbjct: 1422 GLRSARNRRASYHVRDTSPSPMERRKPHQSSKKVSWLMLSMHVE-PRYIPQLGDEVVYLR 1480

Query: 874  QGHQEYINYSGSREVGPWITVKGNIRAVEFCKVESLEYATASGSGDSCCKMTLKFIDPTS 933
            QGHQEYI YSGS E GPW +VKG IRAVEFCKVE LEY+  +GSGDSCCKMTL+F+DPTS
Sbjct: 1481 QGHQEYITYSGSHEAGPWTSVKGIIRAVEFCKVEGLEYSPFAGSGDSCCKMTLQFVDPTS 1540

Query: 934  SVSNMTFRLTLPEVTGFPDFLVERTRFDAAIQRNWTCRDKCKVWWKNESDEDGSWWDGRV 993
             V   TF+LTLPEVT FPDFLVERTR+DAAIQRNWT RDKC+VWWKNE +EDGSWWDGR+
Sbjct: 1541 HVFGKTFKLTLPEVTSFPDFLVERTRYDAAIQRNWTSRDKCRVWWKNEGEEDGSWWDGRI 1600

Query: 994  LSVKPKSSEFPDSPWERYTVQYKTEPTETHLHSPWELFDSDTQWEQPRIDDDNRNKLLSA 1053
            LSVK +S EFPDSPW+RY ++Y++EPTETHLHSPWEL+D  TQWEQP IDD++RNKLLS+
Sbjct: 1601 LSVKARSPEFPDSPWDRYVIRYRSEPTETHLHSPWELYDIGTQWEQPHIDDESRNKLLSS 1660

Query: 1054 FAKLEQSANRVQDQYGVQKLKQVSQKTNFTNRFPVPLSLDVIQSRLENNYYRGLEAVKHD 1113
             AKLEQS ++ QD YG+QKLKQVSQK+NF NRFPVPLSL+VIQSRL+N YYR +EAVKHD
Sbjct: 1661 LAKLEQSGDKPQDYYGIQKLKQVSQKSNFLNRFPVPLSLEVIQSRLKNQYYRSMEAVKHD 1720

Query: 1114 IAVMLSNAESYFGRNTDLSTKIKRLSDLVTRTLSSL 1149
            + VMLSNAE+YF +N +LS K++RLS+  TR LSS+
Sbjct: 1721 VKVMLSNAETYFVKNAELSMKVRRLSEWFTRMLSSI 1756

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356558137|ref|XP_003547364.1| PREDICTED: uncharacterized protein LOC100818665 [Glycine max] Back     alignment and taxonomy information
>gi|356532519|ref|XP_003534819.1| PREDICTED: uncharacterized protein LOC100819598 [Glycine max] Back     alignment and taxonomy information
>gi|449433431|ref|XP_004134501.1| PREDICTED: uncharacterized protein LOC101214610 [Cucumis sativus] Back     alignment and taxonomy information
>gi|124359647|gb|ABN06020.1| Cytochrome cd1-nitrite reductase-like, C-terminal haem d1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357449001|ref|XP_003594776.1| Bromodomain and WD repeat-containing protein [Medicago truncatula] gi|355483824|gb|AES65027.1| Bromodomain and WD repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449517975|ref|XP_004166019.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101214610, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|225437555|ref|XP_002270469.1| PREDICTED: uncharacterized protein LOC100248563 [Vitis vinifera] Back     alignment and taxonomy information
>gi|9759426|dbj|BAB09913.1| WD-40 repeat protein-like [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297795697|ref|XP_002865733.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] gi|297311568|gb|EFH41992.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1159
TAIR|locus:21580441677 AT5G49430 "AT5G49430" [Arabido 0.455 0.314 0.514 1.8e-259
TAIR|locus:20619971520 AT2G47410 "AT2G47410" [Arabido 0.265 0.202 0.608 2e-190
ZFIN|ZDB-GENE-041111-120 2008 brwd1 "bromodomain and WD repe 0.251 0.145 0.264 1.3e-31
ZFIN|ZDB-GENE-050208-261 1805 phip "pleckstrin homology doma 0.152 0.098 0.306 3.6e-31
FB|FBgn0011785 2232 BRWD3 "BRWD3" [Drosophila mela 0.330 0.171 0.257 3.7e-31
MGI|MGI:1890651 2304 Brwd1 "bromodomain and WD repe 0.268 0.134 0.286 5.7e-31
UNIPROTKB|Q9NSI6 2320 BRWD1 "Bromodomain and WD repe 0.404 0.202 0.242 3.3e-30
UNIPROTKB|F1N8L6 1495 BRWD3 "Uncharacterized protein 0.144 0.112 0.321 4.3e-30
UNIPROTKB|F1NXP9 1818 PHIP "Uncharacterized protein" 0.377 0.240 0.233 1e-29
UNIPROTKB|F1N1C9 1658 BRWD3 "Uncharacterized protein 0.411 0.287 0.240 1.8e-29
TAIR|locus:2158044 AT5G49430 "AT5G49430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1381 (491.2 bits), Expect = 1.8e-259, Sum P(3) = 1.8e-259
 Identities = 292/567 (51%), Positives = 381/567 (67%)

Query:   596 NHLQNGTIQPSELKEILTPVSTKLRIRSKRILRDADVENQNNG----CDALHGSSLDIKP 651
             N  QN T +  +L + L P+ST L+IRSKR+ R  D   +  G     D   G S D   
Sbjct:  1135 NSSQNVTHR-HDLIDSLPPISTTLKIRSKRVSRAPDTSLRQEGKSLSIDQETGGS-DALN 1192

Query:   652 NSLPEVLESDGTNRTSSDRGADGSQRLNAQIDSTSEHDP--LGSHSHSHD-PLGSHSHSH 708
             +   +  + D T     D G  G++ ++ + D   E +P    + S ++D P+   SHSH
Sbjct:  1193 DGFEDA-KCDLTLDCQKD-GVVGTE-ISLRNDCVLELNPQICDALSIANDVPV---SHSH 1246

Query:   709 SRKMFNVVYRRSKTNRDRTNSEGDGGGVGE------STLNANNNNFHESATDGSRRTRSM 762
              ++MF+ VYRR K+ + + N + D     E      S  + + +  HE A++G   T   
Sbjct:  1247 PKRMFDFVYRR-KSRKHKNNLDRDAALTKEVSPGSCSQDHGSGSKSHEGASNGFHGTELN 1305

Query:   763 GLKTTTCDPDNVSSNLRLEQHNQPEDMYSGHNRSTSRCQLPHEEWGSSSKMTVGLRSTRN 822
             GL+ +         +L    H Q  D  S  +R     Q   EE  S+S  T+ LRSTRN
Sbjct:  1306 GLEKS-------EGSLT---HIQ--DKISD-SRGNQNSQ---EELRSASGATLRLRSTRN 1349

Query:   823 RRTSYLFCDSSPIDRRKTHQSLRKGSWLMLSTHEEGSRYIPQLGDEVVYLRQGHQEYINY 882
             R+++Y F ++ PI+ +K  Q +   SWL LS HEEGSRYIPQ+GDEV YLRQGHQEY+N+
Sbjct:  1350 RKSTYPFSETKPIETKKPQQLIENVSWLTLSIHEEGSRYIPQMGDEVAYLRQGHQEYLNF 1409

Query:   883 SGSREVGPWITVKG-NIRAVEFCKVESLEYATASGSGDSCCKMTLKFIDPTSSVSNMTFR 941
             S  REV PW ++KG NI+AVE CKVESLEYAT  GSGDSCCKM LK IDP S V N  F+
Sbjct:  1410 SSLREVAPWTSIKGGNIKAVEICKVESLEYATLPGSGDSCCKMILKVIDPNSEVFNKAFK 1469

Query:   942 LTLPEVTGFPDFLVERTRFDAAIQRNWTCRDKCKVWWKNESDEDGSWWDGRVLSVKPKSS 1001
             LTLPEV  FPDFLVER+R++AAIQRNWTCRDKCKVWW++E +EDGSWW+GR+L+VKPKS 
Sbjct:  1470 LTLPEVVTFPDFLVERSRYEAAIQRNWTCRDKCKVWWRDEGEEDGSWWEGRILAVKPKSP 1529

Query:  1002 EFPDSPWERYTVQYKTEPTETHLHSPWELFDSDTQWEQPRIDDDNRNKLLSAFAKLEQSA 1061
             +FPDSPWERYTV+YK++P ETHLHSPWELFD+DT+WEQP IDD+ RN+LLSA  KLE S 
Sbjct:  1530 DFPDSPWERYTVKYKSDPAETHLHSPWELFDADTKWEQPHIDDEQRNRLLSALTKLETSD 1589

Query:  1062 NRVQDQYGVQKLKQVSQKTNFTNRFPVPLSLDVIQSRLENNYYRGLEAVKHDIAVMLSNA 1121
              R QD +G++KL Q    ++++NRFPVPLSL+VI+SRLENNYYR +EA++HD++VMLSNA
Sbjct:  1590 KRTQDSFGLRKLNQTVGNSSYSNRFPVPLSLEVIRSRLENNYYRSVEALRHDVSVMLSNA 1649

Query:  1122 ESYFGRNTDLSTKIKRLSDLVTRTLSS 1148
             E++FGRN  ++ KI  LS+   RTL S
Sbjct:  1650 ETFFGRNKSVAAKISNLSNWFDRTLPS 1676
GO:0000166 "nucleotide binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
TAIR|locus:2061997 AT2G47410 "AT2G47410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041111-120 brwd1 "bromodomain and WD repeat domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-261 phip "pleckstrin homology domain interacting protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0011785 BRWD3 "BRWD3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1890651 Brwd1 "bromodomain and WD repeat domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NSI6 BRWD1 "Bromodomain and WD repeat-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8L6 BRWD3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXP9 PHIP "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N1C9 BRWD3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1159
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 5e-45
smart00297107 smart00297, BROMO, bromo domain 1e-09
pfam0043984 pfam00439, Bromodomain, Bromodomain 1e-09
cd0436999 cd04369, Bromodomain, Bromodomain 8e-07
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 6e-04
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 0.001
cd05525106 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa 0.002
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information 
 Score =  158 bits (401), Expect = 5e-45
 Identities = 57/129 (44%), Positives = 80/129 (62%), Gaps = 2/129 (1%)

Query: 1021 ETHLHSPWELFDSDTQWEQPRIDDDNRNKLLSAFAKLEQSANRVQDQYGVQKLKQVSQKT 1080
               L S WELFD    WEQP I D+ R +L+S   KL  S      +Y    +   +   
Sbjct: 2    YNPLSSEWELFDPG--WEQPHIRDEERERLISGLDKLLLSLQLEIAEYFEYPVDLRAWYP 59

Query: 1081 NFTNRFPVPLSLDVIQSRLENNYYRGLEAVKHDIAVMLSNAESYFGRNTDLSTKIKRLSD 1140
            ++ NR PVP+ L+ I+SRLEN YYR LEA++HD+ ++LSNAE++   N++++ K KRLSD
Sbjct: 60   DYWNRVPVPMDLETIRSRLENRYYRSLEALRHDVRLILSNAETFNEPNSEIAKKAKRLSD 119

Query: 1141 LVTRTLSSL 1149
             + R LSSL
Sbjct: 120  WLLRILSSL 128

WDR9 is a human gene located in the Down Syndrome critical region-2 of chromosome 21. It encodes for a nuclear protein containing WD40 repeats and two bromodomains, which may function as a transcriptional regulator involved in chromatin remodeling and play a role in embryonic development. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. Length = 128
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1159
KOG06441113 consensus Uncharacterized conserved protein, conta 100.0
PF0650783 Auxin_resp: Auxin response factor; InterPro: IPR01 99.82
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.8
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.73
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.73
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.7
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.7
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.7
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.7
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.69
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.69
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.69
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.69
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.68
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.68
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.68
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.67
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.67
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.67
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.67
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.67
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.66
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.66
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.66
smart00297107 BROMO bromo domain. 99.66
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.65
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.64
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.64
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.63
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.63
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.62
KOG1474 640 consensus Transcription initiation factor TFIID, s 99.6
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.6
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.59
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.59
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.56
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.51
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.49
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.41
COG5076 371 Transcription factor involved in chromatin remodel 99.38
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 98.92
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 98.88
KOG0263707 consensus Transcription initiation factor TFIID, s 98.77
KOG1472720 consensus Histone acetyltransferase SAGA/ADA, cata 98.61
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 98.54
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 98.34
KOG0266456 consensus WD40 repeat-containing protein [General 98.3
KOG0266456 consensus WD40 repeat-containing protein [General 98.25
PTZ00421493 coronin; Provisional 98.22
KOG1827 629 consensus Chromatin remodeling complex RSC, subuni 98.11
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 98.1
KOG0279315 consensus G protein beta subunit-like protein [Sig 98.08
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 98.06
KOG0295406 consensus WD40 repeat-containing protein [Function 98.04
KOG0282503 consensus mRNA splicing factor [Function unknown] 98.0
KOG14451012 consensus Tumor-specific antigen (contains WD repe 97.97
KOG00081563 consensus Transcription initiation factor TFIID, s 97.95
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.85
PLN00181793 protein SPA1-RELATED; Provisional 97.84
KOG0279315 consensus G protein beta subunit-like protein [Sig 97.83
KOG0286343 consensus G-protein beta subunit [General function 97.82
PTZ00420568 coronin; Provisional 97.79
KOG2111346 consensus Uncharacterized conserved protein, conta 97.76
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 97.69
KOG0286343 consensus G-protein beta subunit [General function 97.69
PTZ00421493 coronin; Provisional 97.63
KOG0772641 consensus Uncharacterized conserved protein, conta 97.61
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.58
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.58
KOG0282503 consensus mRNA splicing factor [Function unknown] 97.56
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 97.54
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 97.53
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 97.49
KOG0647347 consensus mRNA export protein (contains WD40 repea 97.47
PTZ00420568 coronin; Provisional 97.46
KOG0263707 consensus Transcription initiation factor TFIID, s 97.45
KOG0278334 consensus Serine/threonine kinase receptor-associa 97.42
KOG0315311 consensus G-protein beta subunit-like protein (con 97.4
KOG0319775 consensus WD40-repeat-containing subunit of the 18 97.4
KOG1472 720 consensus Histone acetyltransferase SAGA/ADA, cata 97.39
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 97.35
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 97.34
KOG1474 640 consensus Transcription initiation factor TFIID, s 97.33
KOG0275508 consensus Conserved WD40 repeat-containing protein 97.3
KOG0771398 consensus Prolactin regulatory element-binding pro 97.29
KOG0303472 consensus Actin-binding protein Coronin, contains 97.25
KOG0318603 consensus WD40 repeat stress protein/actin interac 97.23
KOG0291893 consensus WD40-repeat-containing subunit of the 18 97.21
KOG0315311 consensus G-protein beta subunit-like protein (con 97.19
KOG0645312 consensus WD40 repeat protein [General function pr 97.19
PLN00181793 protein SPA1-RELATED; Provisional 97.18
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 97.15
KOG0293519 consensus WD40 repeat-containing protein [Function 97.14
KOG0275508 consensus Conserved WD40 repeat-containing protein 97.14
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 97.13
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 97.12
KOG1407313 consensus WD40 repeat protein [Function unknown] 97.1
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 97.1
KOG0301745 consensus Phospholipase A2-activating protein (con 97.07
KOG1828 418 consensus IRF-2-binding protein CELTIX-1, contains 97.02
KOG1828 418 consensus IRF-2-binding protein CELTIX-1, contains 97.01
KOG1273405 consensus WD40 repeat protein [General function pr 97.01
KOG0316307 consensus Conserved WD40 repeat-containing protein 96.98
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.97
KOG0296399 consensus Angio-associated migratory cell protein 96.94
KOG0008 1563 consensus Transcription initiation factor TFIID, s 96.93
KOG0281499 consensus Beta-TrCP (transducin repeats containing 96.93
KOG0293519 consensus WD40 repeat-containing protein [Function 96.91
KOG2110391 consensus Uncharacterized conserved protein, conta 96.9
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 96.89
KOG0265338 consensus U5 snRNP-specific protein-like factor an 96.88
KOG0646476 consensus WD40 repeat protein [General function pr 96.87
KOG0291893 consensus WD40-repeat-containing subunit of the 18 96.85
KOG0289506 consensus mRNA splicing factor [General function p 96.81
KOG0302440 consensus Ribosome Assembly protein [General funct 96.72
KOG2096420 consensus WD40 repeat protein [General function pr 96.7
KOG0295406 consensus WD40 repeat-containing protein [Function 96.7
KOG0319775 consensus WD40-repeat-containing subunit of the 18 96.57
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 96.57
KOG0265338 consensus U5 snRNP-specific protein-like factor an 96.57
KOG0316307 consensus Conserved WD40 repeat-containing protein 96.54
KOG0300481 consensus WD40 repeat-containing protein [Function 96.52
KOG0973942 consensus Histone transcription regulator HIRA, WD 96.42
KOG0296399 consensus Angio-associated migratory cell protein 96.42
KOG0269839 consensus WD40 repeat-containing protein [Function 96.4
KOG0289506 consensus mRNA splicing factor [General function p 96.39
KOG0640430 consensus mRNA cleavage stimulating factor complex 96.39
KOG0318603 consensus WD40 repeat stress protein/actin interac 96.38
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 96.37
KOG0308735 consensus Conserved WD40 repeat-containing protein 96.33
KOG0283712 consensus WD40 repeat-containing protein [Function 96.26
KOG0288459 consensus WD40 repeat protein TipD [General functi 96.24
KOG4283397 consensus Transcription-coupled repair protein CSA 96.24
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 96.22
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.17
KOG0310487 consensus Conserved WD40 repeat-containing protein 96.14
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 96.08
COG2319466 FOG: WD40 repeat [General function prediction only 96.04
KOG1539910 consensus WD repeat protein [General function pred 96.04
KOG0270463 consensus WD40 repeat-containing protein [Function 95.99
KOG0639705 consensus Transducin-like enhancer of split protei 95.97
KOG0302440 consensus Ribosome Assembly protein [General funct 95.97
KOG0294362 consensus WD40 repeat-containing protein [Function 95.95
KOG0267825 consensus Microtubule severing protein katanin p80 95.94
KOG0645312 consensus WD40 repeat protein [General function pr 95.92
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 95.92
KOG2048691 consensus WD40 repeat protein [General function pr 95.92
KOG1274933 consensus WD40 repeat protein [General function pr 95.89
KOG0267825 consensus Microtubule severing protein katanin p80 95.87
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 95.85
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 95.8
COG2319466 FOG: WD40 repeat [General function prediction only 95.77
KOG0284464 consensus Polyadenylation factor I complex, subuni 95.76
KOG0281499 consensus Beta-TrCP (transducin repeats containing 95.76
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 95.73
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 95.69
KOG0283712 consensus WD40 repeat-containing protein [Function 95.64
PRK01742429 tolB translocation protein TolB; Provisional 95.62
KOG02921202 consensus Vesicle coat complex COPI, alpha subunit 95.57
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 95.51
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 95.51
KOG0290364 consensus Conserved WD40 repeat-containing protein 95.51
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 95.5
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 95.5
KOG0973942 consensus Histone transcription regulator HIRA, WD 95.49
KOG0300481 consensus WD40 repeat-containing protein [Function 95.49
KOG02921202 consensus Vesicle coat complex COPI, alpha subunit 95.46
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 95.45
KOG0278334 consensus Serine/threonine kinase receptor-associa 95.41
KOG0308735 consensus Conserved WD40 repeat-containing protein 95.39
KOG0268433 consensus Sof1-like rRNA processing protein (conta 95.38
KOG2110391 consensus Uncharacterized conserved protein, conta 95.37
KOG0269839 consensus WD40 repeat-containing protein [Function 95.35
KOG1407313 consensus WD40 repeat protein [Function unknown] 95.18
KOG0644 1113 consensus Uncharacterized conserved protein, conta 95.17
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 95.05
KOG0643327 consensus Translation initiation factor 3, subunit 95.01
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 94.93
KOG0268433 consensus Sof1-like rRNA processing protein (conta 94.88
KOG0294362 consensus WD40 repeat-containing protein [Function 94.65
KOG0313423 consensus Microtubule binding protein YTM1 (contai 94.56
KOG2048691 consensus WD40 repeat protein [General function pr 94.36
KOG0646476 consensus WD40 repeat protein [General function pr 94.28
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 94.27
KOG14081080 consensus WD40 repeat protein [Function unknown] 94.2
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 94.14
KOG2139445 consensus WD40 repeat protein [General function pr 94.1
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 94.09
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 94.08
KOG2055514 consensus WD40 repeat protein [General function pr 94.07
KOG4328498 consensus WD40 protein [Function unknown] 94.02
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 93.91
COG5076371 Transcription factor involved in chromatin remodel 93.85
KOG0313423 consensus Microtubule binding protein YTM1 (contai 93.74
KOG14081080 consensus WD40 repeat protein [Function unknown] 93.73
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 93.65
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 93.61
KOG2055514 consensus WD40 repeat protein [General function pr 93.58
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 93.48
PRK05137435 tolB translocation protein TolB; Provisional 93.48
PRK05137435 tolB translocation protein TolB; Provisional 93.43
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 93.41
KOG0310487 consensus Conserved WD40 repeat-containing protein 93.38
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 93.37
KOG2321703 consensus WD40 repeat protein [General function pr 93.29
KOG0284464 consensus Polyadenylation factor I complex, subuni 93.14
KOG0299479 consensus U3 snoRNP-associated protein (contains W 92.9
KOG0306888 consensus WD40-repeat-containing subunit of the 18 92.83
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 92.79
KOG0647347 consensus mRNA export protein (contains WD40 repea 92.39
PRK04922433 tolB translocation protein TolB; Provisional 92.33
KOG0288459 consensus WD40 repeat protein TipD [General functi 92.27
KOG14451012 consensus Tumor-specific antigen (contains WD repe 92.18
PRK04922433 tolB translocation protein TolB; Provisional 92.12
PRK03629429 tolB translocation protein TolB; Provisional 91.82
PRK00178430 tolB translocation protein TolB; Provisional 91.8
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 91.57
KOG2106626 consensus Uncharacterized conserved protein, conta 91.53
PRK11028330 6-phosphogluconolactonase; Provisional 91.42
KOG1063764 consensus RNA polymerase II elongator complex, sub 91.37
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 91.35
KOG0306888 consensus WD40-repeat-containing subunit of the 18 91.32
KOG4547541 consensus WD40 repeat-containing protein [General 91.22
KOG0649325 consensus WD40 repeat protein [General function pr 91.18
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 91.15
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 91.06
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 91.04
KOG0299479 consensus U3 snoRNP-associated protein (contains W 91.01
KOG0641350 consensus WD40 repeat protein [General function pr 90.98
PRK03629429 tolB translocation protein TolB; Provisional 90.97
PRK00178430 tolB translocation protein TolB; Provisional 90.89
PRK02889427 tolB translocation protein TolB; Provisional 90.7
PRK11028330 6-phosphogluconolactonase; Provisional 90.62
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 90.56
KOG2096420 consensus WD40 repeat protein [General function pr 90.51
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 90.36
KOG1539910 consensus WD repeat protein [General function pred 90.35
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 90.2
KOG0643327 consensus Translation initiation factor 3, subunit 90.12
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 90.09
PRK02889427 tolB translocation protein TolB; Provisional 90.09
KOG0772641 consensus Uncharacterized conserved protein, conta 89.87
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 89.62
KOG12401431 consensus Protein kinase containing WD40 repeats [ 89.41
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 88.92
KOG4227609 consensus WD40 repeat protein [General function pr 88.88
KOG1310758 consensus WD40 repeat protein [General function pr 88.86
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 88.75
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 88.68
PRK01742429 tolB translocation protein TolB; Provisional 88.66
KOG0301745 consensus Phospholipase A2-activating protein (con 88.49
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 88.01
KOG1273405 consensus WD40 repeat protein [General function pr 87.87
PRK04792448 tolB translocation protein TolB; Provisional 87.86
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 87.75
KOG1274933 consensus WD40 repeat protein [General function pr 87.58
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 87.31
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 87.29
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 87.28
KOG4497447 consensus Uncharacterized conserved protein WDR8, 87.27
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 86.68
smart0074361 Agenet Tudor-like domain present in plant sequence 86.62
PRK04043419 tolB translocation protein TolB; Provisional 86.53
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 86.38
PRK04792448 tolB translocation protein TolB; Provisional 85.43
KOG1334559 consensus WD40 repeat protein [General function pr 85.27
KOG1188376 consensus WD40 repeat protein [General function pr 85.07
KOG2314698 consensus Translation initiation factor 3, subunit 84.87
KOG0640430 consensus mRNA cleavage stimulating factor complex 84.78
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 84.71
KOG3881412 consensus Uncharacterized conserved protein [Funct 84.59
COG4946668 Uncharacterized protein related to the periplasmic 84.49
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 83.93
KOG4547541 consensus WD40 repeat-containing protein [General 83.77
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 83.58
KOG1063764 consensus RNA polymerase II elongator complex, sub 83.26
PRK01029428 tolB translocation protein TolB; Provisional 83.19
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 82.69
KOG1272545 consensus WD40-repeat-containing subunit of the 18 82.51
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 82.45
KOG15381081 consensus Uncharacterized conserved protein WDR10, 82.34
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 82.22
PRK04043419 tolB translocation protein TolB; Provisional 82.15
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 81.82
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 81.34
KOG0649325 consensus WD40 repeat protein [General function pr 81.23
KOG4283397 consensus Transcription-coupled repair protein CSA 80.52
KOG4328498 consensus WD40 protein [Function unknown] 80.06
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=6.3e-121  Score=1054.15  Aligned_cols=696  Identities=49%  Similarity=0.761  Sum_probs=518.7

Q ss_pred             CCcccCCcEEEEEccCCeeeEEeecCcceeeeeeeCCCCCEEEEecCceeEEEEecCCCCCccCCccccccccCCcccee
Q 001090            1 MSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQFFLGDYRPLVQ   80 (1159)
Q Consensus         1 lSAG~DG~I~lWDI~~G~~Ir~f~~g~~~i~D~~FSPDGt~~a~tD~~G~l~Ifg~G~g~~~~~~p~EQFF~tDYrpLir   80 (1159)
                      |||||||.++||||+.|.+|++|..++++++|||||+|||+||++|++|+|+|+|+|++++++.++|+|||++||||||+
T Consensus       412 msag~dgst~iwdi~eg~pik~y~~gh~kl~d~kFSqdgts~~lsd~hgql~i~g~gqs~s~k~ak~dqffl~dyrplir  491 (1113)
T KOG0644|consen  412 MSAGYDGSTIIWDIWEGIPIKHYFIGHGKLVDGKFSQDGTSIALSDDHGQLYILGTGQSKSQKKAKYDQFFLGDYRPLIR  491 (1113)
T ss_pred             hhccCCCceEeeecccCCcceeeecccceeeccccCCCCceEecCCCCCceEEeccCCCccccccccceEeecCcccccc
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCccccccCcCCcccCCCCCcccCCCCCCCchhHHhhhhhhhcccCccccCCccccccCCCCcCCCccccccccCcc
Q 001090           81 DTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLD  160 (1159)
Q Consensus        81 D~~g~vlDe~Tq~~PHL~~~~~~L~D~~~~PYp~~~Q~~~~~rrl~~l~~e~~p~~~~~~vg~~~~~~~~~~~~p~~~~~  160 (1159)
                      |.||||+|++||++||+ +||++|||.+|+|||.+||++||+||++|+                     +|+|+||    
T Consensus       492 dTn~~vldqeTq~~ph~-~~p~~l~ds~~iphpe~yqtl~q~rr~sa~---------------------dh~mp~l----  545 (1113)
T KOG0644|consen  492 DTNGYVLDQETQLAPHR-NPPDFLCDSDMIPHPEPYQTLFQGRRLSAL---------------------DHLMPPL----  545 (1113)
T ss_pred             cccchhhhhHhhhcccc-CCCCceeccCCCcCCchhhhcccccccchh---------------------hhcCCcc----
Confidence            99999999999999994 779999999999999999999999999988                     7888888    


Q ss_pred             cccCCCccccccccCCcccccccCCCCCcccccccccccccccccCCCCCCCCCCcCCcCCCCCCCccchhhhhhccccc
Q 001090          161 VMIDPLPEFIDVMDWEPENEVQSDDNDSEYNVAEEYSTEEKGSLSSTSSGDSECSAEDSEDGENPMDGLRRSKRKKQKAE  240 (1159)
Q Consensus       161 ~~~~~~~e~~d~~~wepe~ev~sdd~dseyn~~ee~ss~e~~~~~~~ss~~~~~s~~~s~~~~~~~~~lrrs~rkk~k~~  240 (1159)
                             ||+|+|+||||.+|+||+||||||..+|++                                           
T Consensus       546 -------~fia~~~~E~e~~Vls~~nds~~~~~~es~-------------------------------------------  575 (1113)
T KOG0644|consen  546 -------EFIATMDWEPEEQVLSDQNDSEYNRSPESL-------------------------------------------  575 (1113)
T ss_pred             -------cchhhhccccchhhhhhcccccccCCcccc-------------------------------------------
Confidence                   999999999999999999999999966511                                           


Q ss_pred             eeeeeccccccccccccccCCCcCCCCccccccCCCcccccccCCCccccchHHHHHHHHhhhhhhccCCCCCCCCCCCC
Q 001090          241 VEIMTSSGRRVKRRILDESEGNAAFGNKRTRKSGNRQKSSRRKSSTSKSLRPQRAAARNARSFFSKITGASTDGEDVDGS  320 (1159)
Q Consensus       241 ~~~~tssgrrv~krnlde~~~~~~~~~~r~rk~~~~~k~s~~kssk~k~~rpqr~aarnal~~fski~~~~~~~ed~d~~  320 (1159)
                                      +|.+|. .+.-+|+++.+.|.|-+++|++++|+.||+|||||||+++||||+|++.+.+.    
T Consensus       576 ----------------seldg~-isq~krt~n~r~g~k~s~~~hg~s~ss~~~R~~~Rn~~~~isk~sg~~~~~~s----  634 (1113)
T KOG0644|consen  576 ----------------SELDGM-ISQLKRTQNQRMGAKQSKRKHGLSKSSRPPRAAARNASSDISKISGISLDRKS----  634 (1113)
T ss_pred             ----------------hhhhhh-hhhhhhhhccccccchhhccCCCCccccCCcccccccchhhccCCCccccccc----
Confidence                            888888 88899999999999999999999999999999999999999999999998763    


Q ss_pred             CCCCCcccccccccccchhhhhhhhhhhhhhcccCcccccccccccCCCCCcccccccCCceEEEEeeccCCCccccccc
Q 001090          321 EGELSESESDLQDSYIESEESGRSLLNEQRKHSKGKGISLDDSEDVTKLDTPESHVNAGIRRLVLKLPVRDSNKHELQER  400 (1159)
Q Consensus       321 ~~~~s~s~~~~~ds~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~e~~~n~~~~rlvl~~~~rd~~~~~~~~~  400 (1159)
                          ++.+..+|+.....-+..+.+.+++                                +.+.++++.+     ..+.
T Consensus       635 ----g~~e~~~q~~~~~p~eq~~~~~~~~--------------------------------~wR~e~~vce-----~leg  673 (1113)
T KOG0644|consen  635 ----GQVEGVTQMHQNAPSEQIATLRTLQ--------------------------------AWRREVVVCE-----ELEG  673 (1113)
T ss_pred             ----cCCccchhhccCCCHHHHhhhhHHH--------------------------------HhhcccCccc-----cccc
Confidence                4455555555333333333322111                                1111111111     0111


Q ss_pred             cccccccccceeccCchhhhccccCCCCcccccCCCCCCCCcccccccccCCCCcccccccccccCcccCCceeeccccc
Q 001090          401 TSDKCNQLVSVIGTSSEAHQEATEGNGNRVSYVGNNCSSVDANCGLMERRGRGQFDKLEDYLNLSNGYKDGKIRWGGVRA  480 (1159)
Q Consensus       401 ~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~v~~  480 (1159)
                      ++++.+.-                                            .+.. ..+-. ..+||+++.        
T Consensus       674 t~pe~ed~--------------------------------------------~~~~-dtdev-~rng~kngR--------  699 (1113)
T KOG0644|consen  674 TFPELEDE--------------------------------------------AMAV-DTDEV-ERNGYKNGR--------  699 (1113)
T ss_pred             cCcccccc--------------------------------------------cccc-ccchh-hhcCCCccc--------
Confidence            11100000                                            0000 00000 011222211        


Q ss_pred             ccccccccccCCCCCCCCCCCcccCcccchhhcccCCCCCCCCCCCCCcccccccCCCCCCCccccccccccCCCCCCcc
Q 001090          481 RSSKRLKIGEMMPLDANNGSGIHLDDDKEKESEVNGHVKPEKDGIDISCGEEITNCGDNTDEVPLKNVKNLSGENNDVYS  560 (1159)
Q Consensus       481 ~~~k~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  560 (1159)
                       .- ++++.++       .|+                                                           
T Consensus       700 -Kr-k~~l~~~-------~Sn-----------------------------------------------------------  711 (1113)
T KOG0644|consen  700 -KR-KLELRHP-------LSN-----------------------------------------------------------  711 (1113)
T ss_pred             -cc-chhccCc-------ccc-----------------------------------------------------------
Confidence             00 0111100       000                                                           


Q ss_pred             CCcccccccCCccccccCCCCccccCCCCCCCCCCCCCCCCCCCCcccccccCCceeeeeecccccccCccccCCCCCcc
Q 001090          561 GDASCKEQQSGFSELNYYDESKCVNTTDEDTTPYPNHLQNGTIQPSELKEILTPVSTKLRIRSKRILRDADVENQNNGCD  640 (1159)
Q Consensus       561 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  640 (1159)
                              .+                            ..++.-  ..         .|.+++....+.|+.      +.
T Consensus       712 --------ks----------------------------d~vtlV--~~---------d~~~~~~~~s~aP~~------~l  738 (1113)
T KOG0644|consen  712 --------KS----------------------------DSVTLV--SQ---------DLADQSTCVSRAPNG------GL  738 (1113)
T ss_pred             --------cc----------------------------ccchhh--hh---------hhhcccceeeeCCcc------cc
Confidence                    00                            000000  00         011222222232321      10


Q ss_pred             cccCCCCCCCCCCCCcccccCCCCCcccCCCC--CCcccccccccCCCCCCCCCCCccCCCCCCCCCCCCcchhhHHHhh
Q 001090          641 ALHGSSLDIKPNSLPEVLESDGTNRTSSDRGA--DGSQRLNAQIDSTSEHDPLGSHSHSHDPLGSHSHSHSRKMFNVVYR  718 (1159)
Q Consensus       641 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~v~r  718 (1159)
                      ..-++.+  +..+...++||+.++.....+..  ||..+..+++..+.        ++..+....  |.+..++    ||
T Consensus       739 d~lNDgf--sD~kiD~t~D~se~~gs~~Eis~Rndrr~eS~~~esds~--------SSa~sv~l~--dgsi~~~----ts  802 (1113)
T KOG0644|consen  739 DSLNDGF--SDVKIDLTLDCSEDSGSGEEISLRNDRRSESNPEESDSL--------SSAYSVWLA--DGSINLQ----TS  802 (1113)
T ss_pred             ccccccc--ccccccchhhhhhcCCcccceeeecchhhccCcccccch--------hhhhheecc--cCCcccc----cc
Confidence            1011111  22334566677777666655554  55555544433333        122223333  3333333    32


Q ss_pred             c-ccccccCCCCCCCCCCCCCccccCCCCCCCCCCCCCccccccccccccccCCCcccccchhccCCCCCccccCCCCCC
Q 001090          719 R-SKTNRDRTNSEGDGGGVGESTLNANNNNFHESATDGSRRTRSMGLKTTTCDPDNVSSNLRLEQHNQPEDMYSGHNRST  797 (1159)
Q Consensus       719 r-~~~~~~~~~~~~~~~~~~e~~~~~n~~~~~~~~~~~~~~~~s~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  797 (1159)
                      | +|-  .|.+                                                                   .+
T Consensus       803 rrgRi--~k~~-------------------------------------------------------------------~s  813 (1113)
T KOG0644|consen  803 RRGRI--TKFC-------------------------------------------------------------------SS  813 (1113)
T ss_pred             ccccc--cccC-------------------------------------------------------------------cc
Confidence            2 222  2222                                                                   12


Q ss_pred             CCCCCCc--ccccCCCcccccccccccccccccCCCCCcccccCccccccccccccccccCCCCCCCCCCCCeEEEechh
Q 001090          798 SRCQLPH--EEWGSSSKMTVGLRSTRNRRTSYLFCDSSPIDRRKTHQSLRKGSWLMLSTHEEGSRYIPQLGDEVVYLRQG  875 (1159)
Q Consensus       798 ~~~~~~~--ee~~s~s~~~~~~rs~~~r~~~~~~p~~~~~~~r~~~~~~~~~sWL~~~~~~~~spYVPQ~GDEVVYfRQG  875 (1159)
                      +...|+.  ++|.++.+.     ..+.|++..  -...+..-..+|+++.+++||++++|+++|+|||||||||+|||||
T Consensus       814 t~a~Lt~e~~~~p~~~~~-----~s~s~s~~~--~~p~~~~~~~~~~~~~~~sWltls~hee~~ryipQmgDEViyfrQg  886 (1113)
T KOG0644|consen  814 TEAELTTELSSPPCSQDK-----GSGSKSHKR--STPAPLENMKPQQLFEKPSWLTLSIHEEGCRYIPQMGDEVIYFRQG  886 (1113)
T ss_pred             chhhhhhcccCCCccccc-----cccccCccc--CCCccccccchhhhcCCceeEEeehhhcCCcccccccceeehhhhh
Confidence            2222222  334444444     223333332  2233555566789999999999999999999999999999999999


Q ss_pred             HHHHHHHhccCCCCCccccc-CCCcceeeEEEEEEEEEecCCCCccceeeEEeeecCCCCCCCCeEEEEcCCCCCCCceE
Q 001090          876 HQEYINYSGSREVGPWITVK-GNIRAVEFCKVESLEYATASGSGDSCCKMTLKFIDPTSSVSNMTFRLTLPEVTGFPDFL  954 (1159)
Q Consensus       876 HeeYLeavr~~~~~PW~~lk-~~LR~~E~CKVvgIkYeI~Pps~tscCkLtL~fLdpaSg~tg~~FsV~Y~p~~d~pDFL  954 (1159)
                      ||+||++++.++. +|++.+ .++-++|.|||+.|.|..+|+++++||+|+|+||||++.+..++|+|+||++.++||||
T Consensus       887 hqeyl~~~~~n~~-~~~~~~p~~~~~v~~~kv~kl~~~~y~~~~~s~c~m~l~~idp~s~~~~k~F~ltlpdlv~fpDFl  965 (1113)
T KOG0644|consen  887 HQEYLEAVRLNNI-ELNNKEPWNKMAVEICKVEKLVYITYPGSGDSCCKMKLAVIDPASKLMDKSFKLTLPDLVTFPDFL  965 (1113)
T ss_pred             hHHHHhhhhhccc-cccccCcccccchhhheeeeeeeeeccCCCcchheeeeeeecchhhhhhccceeecccccCcchhh
Confidence            9999999987644 444332 34778999999999999999999999999999999999999999999999999999999


Q ss_pred             eehhhHHHHhccCCCCCCeEEEeeccCCCCCCcEEEEEEEEecCCCCCCCCCCcceeEEEEcCCCCcccccCCCccccCC
Q 001090          955 VERTRFDAAIQRNWTCRDKCKVWWKNESDEDGSWWDGRVLSVKPKSSEFPDSPWERYTVQYKTEPTETHLHSPWELFDSD 1034 (1159)
Q Consensus       955 Vlr~rYdkAm~rnWsvGDRFrm~fe~ED~idg~Ww~GtIvgv~p~dp~wPdSpWe~L~VrWDn~~~E~eRVSPWEIEpid 1034 (1159)
                      |++++|++|++|||+.||+|++||++++.++|+||+|+|.+++|++|+||+|||+||.|+||++  |++.+||||+++++
T Consensus       966 V~rsrYd~AiQrnW~~~d~crvwwrda~~e~g~WWeG~ils~~pksp~fpdSpwery~v~~~~~--e~~~~spwe~~~i~ 1043 (1113)
T KOG0644|consen  966 VERSRYDAAIQRNWTCRDKCRVWWRDAGEEDGAWWEGRILSVKPKSPDFPDSPWERYIVRYDNT--ETELHSPWEMEPIP 1043 (1113)
T ss_pred             hhhhhHHHHHhhccccccceeEEEccCCCcCCceeeeeeeeccCCCCCCCCCcceeEEEEecCC--cccccCccccCCCc
Confidence            9999999999999999999999999988889999999999999999999999999999999999  99999999999752


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHhhccchhhhhhhhhccccccCcccccCCCCCCHHHHHHHHHcCCCCCHHHHHHHH
Q 001090         1035 TQWEQPRIDDDNRNKLLSAFAKLEQSANRVQDQYGVQKLKQVSQKTNFTNRFPVPLSLDVIQSRLENNYYRGLEAVKHDI 1114 (1159)
Q Consensus      1035 ~p~e~P~id~E~r~kLlsal~klees~~r~~DryGI~~L~~~~e~PdY~~iIk~PMDLsTIr~RLeN~~YRsleaf~~DV 1114 (1159)
                               +|                                    |.+.++.|..|+.|+.||||+|||++++|.+||
T Consensus      1044 ---------de------------------------------------~~~~fpvpls~evi~~rlEn~yYrs~e~~~hdv 1078 (1113)
T KOG0644|consen 1044 ---------DE------------------------------------VDNRFPVPLSLEVIRSRLENNYYRSQEALRHDV 1078 (1113)
T ss_pred             ---------cc------------------------------------cCCCCCCcccHHHHHHHHHhhhhhhhHhhhcch
Confidence                     11                                    556789999999999999999999999999999


Q ss_pred             HHHHHhhhhccCCCCHHHHHHHHHHHHHHHHHhcC
Q 001090         1115 AVMLSNAESYFGRNTDLSTKIKRLSDLVTRTLSSL 1149 (1159)
Q Consensus      1115 rLI~sNA~tFN~p~S~I~k~Ak~L~d~F~~~LkkL 1149 (1159)
                      ..|++||++|++-+..+.-++..|..||.+.|.++
T Consensus      1079 s~mlsnae~~fg~~~~~~~ki~~l~~~~~~Tlpk~ 1113 (1113)
T KOG0644|consen 1079 SVMLSNAETFFGRNKNVAIKISFLSPWFDRTLPKL 1113 (1113)
T ss_pred             hhhhcccceeecccccHHHHhhhcchhhhhhccCC
Confidence            99999999999999999999999999999998764

>PF06507 Auxin_resp: Auxin response factor; InterPro: IPR010525 This pattern represents a conserved region of auxin-responsive transcription factors Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1159
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 5e-06
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 9e-06
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 2e-05
2dat_A123 Possible global transcription activator SNF2L2; br 4e-05
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 5e-05
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 9e-05
2grc_A129 Probable global transcription activator SNF2L4; br 2e-04
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 3e-04
3aad_A292 Transcription initiation factor TFIID subunit 1; p 9e-04
2r0y_A311 Chromatin structure-remodeling complex protein RSC 9e-04
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
 Score = 45.8 bits (109), Expect = 5e-06
 Identities = 20/71 (28%), Positives = 32/71 (45%)

Query: 1089 PLSLDVIQSRLENNYYRGLEAVKHDIAVMLSNAESYFGRNTDLSTKIKRLSDLVTRTLSS 1148
            PL L  I+ ++   YY+ +EA   D+  +  NAE Y+GR + +   + RL          
Sbjct: 55   PLDLITIEKQILTGYYKTVEAFDADMLKVFRNAEKYYGRKSPVGRDVCRLRKAYYNARHE 114

Query: 1149 LKAPQFHDVGQ 1159
              A     VG+
Sbjct: 115  ASAQIDEIVGE 125
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1159
3d7c_A112 General control of amino acid synthesis protein 5; 99.78
2dat_A123 Possible global transcription activator SNF2L2; br 99.78
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.77
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.76
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.76
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.76
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.76
2grc_A129 Probable global transcription activator SNF2L4; br 99.75
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.75
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.75
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.75
3p1f_A119 CREB-binding protein; structural genomics consorti 99.75
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.75
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.75
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.75
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.74
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.74
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.74
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.74
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.73
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.72
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.72
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.72
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.72
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.71
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.71
3uv4_A158 Second bromodomain of human transcription initiat 99.69
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.67
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.66
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.61
3uv5_A 265 Transcription initiation factor TFIID subunit 1; t 99.61
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.6
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.6
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.6
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.59
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.58
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.55
3aad_A 292 Transcription initiation factor TFIID subunit 1; p 99.54
2r0y_A 311 Chromatin structure-remodeling complex protein RSC 99.51
2r10_A 361 Chromatin structure-remodeling complex protein RSC 99.48
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.38
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.02
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 98.7
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 98.66
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 98.56
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 98.52
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 98.52
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 98.48
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 98.45
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 98.44
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 98.42
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 98.41
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.41
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 98.4
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 98.4
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.39
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 98.38
4g56_B357 MGC81050 protein; protein arginine methyltransfera 98.38
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 98.37
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 98.37
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 98.36
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 98.36
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 98.36
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 98.35
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 98.34
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 98.34
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 98.34
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 98.33
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 98.33
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 98.32
2ymu_A577 WD-40 repeat protein; unknown function, two domain 98.31
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 98.3
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 98.3
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 98.29
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 98.29
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 98.28
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 98.28
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 98.28
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 98.28
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 98.27
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 98.26
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 98.25
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 98.24
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 98.23
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 98.22
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 98.22
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 98.22
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 98.22
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 98.21
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 98.21
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 98.2
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 98.19
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 98.19
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 98.18
2pm7_B297 Protein transport protein SEC13, protein transport 98.18
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 98.18
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 98.17
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 98.17
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.17
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 98.16
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 98.16
2pm7_B297 Protein transport protein SEC13, protein transport 98.15
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 98.15
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 98.15
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 98.14
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.13
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 98.13
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.12
4g56_B357 MGC81050 protein; protein arginine methyltransfera 98.12
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 98.11
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 98.11
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 98.1
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 98.1
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 98.1
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 98.09
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 98.08
3jrp_A379 Fusion protein of protein transport protein SEC13 98.08
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 98.08
2ymu_A577 WD-40 repeat protein; unknown function, two domain 98.06
4e54_B435 DNA damage-binding protein 2; beta barrel, double 98.06
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 98.05
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.05
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 98.04
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 98.04
3jrp_A379 Fusion protein of protein transport protein SEC13 98.03
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 98.03
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 98.01
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 98.01
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 98.0
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 98.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 98.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 98.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 97.99
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 97.99
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 97.98
4e54_B435 DNA damage-binding protein 2; beta barrel, double 97.97
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 97.96
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 97.95
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 97.93
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.92
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.91
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.91
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.9
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.9
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.88
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 97.88
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 97.87
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.87
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.87
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 97.87
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.86
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 97.79
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.79
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 97.77
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 97.77
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.76
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 97.74
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 97.74
2xyi_A430 Probable histone-binding protein CAF1; transcripti 97.71
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.64
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.63
3jro_A753 Fusion protein of protein transport protein SEC13 97.62
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.61
3jro_A753 Fusion protein of protein transport protein SEC13 97.61
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 97.58
2xyi_A430 Probable histone-binding protein CAF1; transcripti 97.58
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.51
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 97.5
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 97.46
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.45
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 97.44
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.41
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.37
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 97.37
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.32
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.23
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.14
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.12
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 97.12
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 97.07
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.02
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.96
1k32_A1045 Tricorn protease; protein degradation, substrate g 96.96
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 96.91
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 96.76
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.75
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.75
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.72
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 96.7
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 96.64
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 96.63
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.56
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.45
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 96.45
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 96.38
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.32
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 96.16
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 96.16
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.15
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 96.11
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 96.11
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.03
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 95.92
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 95.88
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.85
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 95.74
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 95.73
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.61
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 95.52
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 95.33
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 95.29
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.27
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.2
1k32_A1045 Tricorn protease; protein degradation, substrate g 95.2
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.05
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 95.05
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 95.02
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 94.92
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 94.77
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 94.58
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 94.43
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 94.09
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 93.64
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 93.59
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 93.56
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 93.53
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 93.49
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 93.36
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 93.04
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 92.73
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 92.65
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 92.56
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 92.28
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 92.26
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 92.06
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 92.01
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 91.88
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 91.05
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 90.68
2qe8_A343 Uncharacterized protein; structural genomics, join 90.63
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 90.58
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 90.28
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 89.06
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 88.67
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 88.46
3qii_A85 PHD finger protein 20; tudor domain, structural ge 88.39
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 88.05
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 87.82
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 87.67
3s6w_A54 Tudor domain-containing protein 3; methylated argi 87.65
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 87.4
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 87.36
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 86.69
2equ_A74 PHD finger protein 20-like 1; tudor domain, struct 86.05
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 86.03
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 85.7
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 85.62
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 85.38
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 85.27
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 84.65
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 84.13
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 84.07
2qe8_A343 Uncharacterized protein; structural genomics, join 83.99
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 83.2
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 83.08
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 81.24
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 80.38
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 80.33
2ldm_A81 Uncharacterized protein; PHF20, tudor domain, epig 80.45
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
Probab=99.78  E-value=4.3e-19  Score=167.99  Aligned_cols=103  Identities=14%  Similarity=0.225  Sum_probs=87.0

Q ss_pred             HHHHHHHHHHHHHHHhhccchhhhhhhhhccccccCcccccCCCCCCHHHHHHHHHcCCCCCHHHHHHHHHHHHHhhhhc
Q 001090         1045 DNRNKLLSAFAKLEQSANRVQDQYGVQKLKQVSQKTNFTNRFPVPLSLDVIQSRLENNYYRGLEAVKHDIAVMLSNAESY 1124 (1159)
Q Consensus      1045 E~r~kLlsal~klees~~r~~DryGI~~L~~~~e~PdY~~iIk~PMDLsTIr~RLeN~~YRsleaf~~DVrLI~sNA~tF 1124 (1159)
                      +.+..+...+..+..    .....-+..+++..++|+||++|++||||+||++||++++|+++++|.+||+|||+||.+|
T Consensus         7 ~l~~~~~~il~~l~~----~~~~~~F~~pvd~~~~pdY~~iIk~PmdL~tI~~kl~~~~Y~s~~~f~~Dv~li~~Na~~y   82 (112)
T 3d7c_A            7 QLYTTLKNLLAQIKS----HPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREY   82 (112)
T ss_dssp             HHHHHHHHHHHHHHH----SGGGGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHc----CCCchhhcCCCCcccccCHHHHccCCcCHHHHHHHHcCCCCcCHHHHHHHHHHHHHHHHHH
Confidence            445555555555532    1122235667777789999999999999999999999999999999999999999999999


Q ss_pred             cCCCCHHHHHHHHHHHHHHHHHhcCCC
Q 001090         1125 FGRNTDLSTKIKRLSDLVTRTLSSLKA 1151 (1159)
Q Consensus      1125 N~p~S~I~k~Ak~L~d~F~~~LkkL~~ 1151 (1159)
                      |+++|.++++|+.|+++|++.|+++..
T Consensus        83 N~~~s~~~~~A~~L~~~f~~~~~~~~~  109 (112)
T 3d7c_A           83 NPPDSEYCRCASALEKFFYFKLKEGGL  109 (112)
T ss_dssp             SCTTSHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHCCC
Confidence            999999999999999999999998764
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1159
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 4e-06
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 4e-05
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 4e-04
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: P300/CAF histone acetyltransferase bromodomain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 45.0 bits (106), Expect = 4e-06
 Identities = 17/113 (15%), Positives = 40/113 (35%), Gaps = 4/113 (3%)

Query: 1038 EQPRIDDDNRNKLLSAFAKLEQSANRVQDQYGVQKLKQVSQKTNFTNRFPVPLSLDVIQS 1097
            ++PR    + ++L S    + Q     Q  +   +  + ++   +      P+ L  +  
Sbjct: 6    KEPR----DPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSE 61

Query: 1098 RLENNYYRGLEAVKHDIAVMLSNAESYFGRNTDLSTKIKRLSDLVTRTLSSLK 1150
            RL+N YY   +    D+  + +N + Y    ++       L       +    
Sbjct: 62   RLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAG 114
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1159
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.74
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.73
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.72
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.72
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.7
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.56
d1tbga_340 beta1-subunit of the signal-transducing G protein 98.55
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 98.52
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.48
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.44
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 98.41
d1tbga_340 beta1-subunit of the signal-transducing G protein 98.3
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.3
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.27
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 98.27
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 98.23
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 98.22
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 98.19
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 98.18
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.13
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 98.11
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 98.1
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.08
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 98.07
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 98.03
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 98.02
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.96
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 97.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 97.95
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.94
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 97.87
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.8
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.78
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 97.73
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.72
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.69
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 97.65
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 97.6
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 97.6
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 97.56
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.44
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.4
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 97.37
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.28
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 97.22
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.19
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.18
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.11
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.05
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 96.88
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 96.79
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 96.73
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 95.63
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 95.55
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 95.37
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 93.78
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 93.28
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 91.3
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 90.7
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 89.69
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 87.61
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 83.41
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 80.45
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.77  E-value=4.1e-19  Score=163.82  Aligned_cols=79  Identities=15%  Similarity=0.283  Sum_probs=74.8

Q ss_pred             hhhhccccccCcccccCCCCCCHHHHHHHHHcCCCCCHHHHHHHHHHHHHhhhhccCCCCHHHHHHHHHHHHHHHHHhc
Q 001090         1070 VQKLKQVSQKTNFTNRFPVPLSLDVIQSRLENNYYRGLEAVKHDIAVMLSNAESYFGRNTDLSTKIKRLSDLVTRTLSS 1148 (1159)
Q Consensus      1070 I~~L~~~~e~PdY~~iIk~PMDLsTIr~RLeN~~YRsleaf~~DVrLI~sNA~tFN~p~S~I~k~Ak~L~d~F~~~Lkk 1148 (1159)
                      +..+++..++|+|+++|+.||||+||++||+++.|+++++|.+||+|||.||.+||+++|+++++|..|+++|.+.|++
T Consensus        23 F~~pv~~~~~pdY~~~I~~PmdL~tI~~kl~~~~Y~s~~~f~~D~~li~~Na~~yN~~~s~~~~~A~~l~~~f~~~~ke  101 (102)
T d3d7ca1          23 FMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKE  101 (102)
T ss_dssp             GSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHSCTTSHHHHHHHHHHHHHHHHHHH
T ss_pred             cCCCCChhhCcCHHHHcCCccCHHHHHHHhccCccCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHhc
Confidence            4566677789999999999999999999999999999999999999999999999999999999999999999999874
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure