Citrus Sinensis ID: 001211
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1123 | 2.2.26 [Sep-21-2011] | |||||||
| Q9HGL2 | 1116 | Uncharacterized calcium-b | yes | no | 0.081 | 0.081 | 0.369 | 4e-15 | |
| Q6BNL1 | 1449 | Actin cytoskeleton-regula | yes | no | 0.376 | 0.291 | 0.261 | 1e-10 | |
| P42566 | 896 | Epidermal growth factor r | yes | no | 0.099 | 0.125 | 0.314 | 1e-10 | |
| Q9WVE9 | 1217 | Intersectin-1 OS=Rattus n | yes | no | 0.059 | 0.055 | 0.415 | 4e-10 | |
| Q15811 | 1721 | Intersectin-1 OS=Homo sap | no | no | 0.140 | 0.091 | 0.295 | 5e-10 | |
| Q96D71 | 796 | RalBP1-associated Eps dom | no | no | 0.109 | 0.154 | 0.307 | 6e-10 | |
| O42287 | 1270 | Intersectin-1 OS=Xenopus | N/A | no | 0.068 | 0.060 | 0.402 | 6e-10 | |
| Q54KI4 | 1196 | Epidermal growth factor r | yes | no | 0.065 | 0.061 | 0.365 | 8e-10 | |
| Q9Z0R4 | 1714 | Intersectin-1 OS=Mus musc | no | no | 0.063 | 0.041 | 0.415 | 8e-10 | |
| P34216 | 1381 | EH domain-containing and | yes | no | 0.083 | 0.068 | 0.317 | 1e-09 |
| >sp|Q9HGL2|YHLA_SCHPO Uncharacterized calcium-binding protein C800.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC800.10c PE=4 SV=1 | Back alignment and function desciption |
|---|
Score = 84.7 bits (208), Expect = 4e-15, Method: Compositional matrix adjust.
Identities = 34/92 (36%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
Query: 397 PWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDS 456
PW + D+ + ++F VD G ++G +A + F++ +LP +VL Q+WDLSD +S+
Sbjct: 252 PW-AIPSQDLTSFCQLFSNVDKAHKGYVSGSEAYSFFLASKLPEDVLAQIWDLSDTNSNG 310
Query: 457 MLSLREFCFALYLMERYREGRPLPAVLPRNVM 488
L++ EFC +LYL++ G+ LP VLP +++
Sbjct: 311 KLNIGEFCISLYLIKLKLSGKELPKVLPSSML 342
|
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812) |
| >sp|Q6BNL1|PAN1_DEBHA Actin cytoskeleton-regulatory complex protein PAN1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAN1 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|P42566|EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens GN=EPS15 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q96D71|REPS1_HUMAN RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens GN=REPS1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q54KI4|EPS15_DICDI Epidermal growth factor receptor substrate 15 homolog OS=Dictyostelium discoideum GN=eps15 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P34216|EDE1_YEAST EH domain-containing and endocytosis protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EDE1 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1123 | ||||||
| 255539262 | 1006 | calcium ion binding protein, putative [R | 0.845 | 0.944 | 0.633 | 0.0 | |
| 449485088 | 1050 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.905 | 0.968 | 0.560 | 0.0 | |
| 356517259 | 1076 | PREDICTED: uncharacterized protein LOC10 | 0.903 | 0.943 | 0.557 | 0.0 | |
| 449455615 | 1027 | PREDICTED: uncharacterized protein LOC10 | 0.885 | 0.967 | 0.551 | 0.0 | |
| 224065677 | 933 | predicted protein [Populus trichocarpa] | 0.780 | 0.939 | 0.595 | 0.0 | |
| 356508604 | 1062 | PREDICTED: uncharacterized protein LOC10 | 0.897 | 0.949 | 0.553 | 0.0 | |
| 297745569 | 996 | unnamed protein product [Vitis vinifera] | 0.824 | 0.929 | 0.582 | 0.0 | |
| 359491847 | 984 | PREDICTED: uncharacterized protein LOC10 | 0.819 | 0.934 | 0.584 | 0.0 | |
| 15218021 | 1019 | calcium-binding EF hand-containing prote | 0.883 | 0.973 | 0.534 | 0.0 | |
| 297845052 | 997 | calcium-binding EF hand family protein [ | 0.863 | 0.972 | 0.519 | 0.0 |
| >gi|255539262|ref|XP_002510696.1| calcium ion binding protein, putative [Ricinus communis] gi|223551397|gb|EEF52883.1| calcium ion binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1148 bits (2970), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 644/1017 (63%), Positives = 743/1017 (73%), Gaps = 67/1017 (6%)
Query: 1 MAG-PNQDQFESFFRRADLDGDGRISGAEAVAFFQGSNLPKQVLAQIWMHADHNHTSYLG 59
MAG PN DQFE++FRRADLDGDGRISG EAV FFQG+NLPKQVLAQIWMHAD + T +LG
Sbjct: 1 MAGQPNMDQFEAYFRRADLDGDGRISGTEAVNFFQGANLPKQVLAQIWMHADQSRTGFLG 60
Query: 60 RQEFYNALKLVTVAQSKRELTPDIVKAALYGPAATKIPPPQINLSATPAQQINSTAAVSV 119
R EF+NALKLVTVAQSKRELTPDIVKAALYGPAA KIPPP+INL ATP QQ+N S
Sbjct: 61 RPEFFNALKLVTVAQSKRELTPDIVKAALYGPAAAKIPPPKINLLATPVQQVNPMMTPSA 120
Query: 120 PQMSVPTQMAPQNFGFRGPGAPNVSQVQQ-------QSIRPYQAAP-----HPTQGSVGP 167
PQM P Q+ GFRGPG PN QQ Q++RP QA P PTQG P
Sbjct: 121 PQMGAPPPTPVQSLGFRGPGLPNAGINQQYFPSPQSQTMRPPQAIPPGIASRPTQGITNP 180
Query: 168 DFSRGGSVMGQTQVMPGSTAPRPPQTMPAGTAPRPPQSMPASTSPHPPQSMPESTAGLNV 227
+FSRG S+MG +QV+P GTA RPP SMP T A ++
Sbjct: 181 EFSRGSSMMGHSQVVP------------TGTASRPPHSMPVPT------------ASPSI 216
Query: 228 PNSNISSDWLSGGAGGASTGSRAISPSTPLMPTNPQTPVSSSSQLINNKSKALVPSGNGF 287
P SNIS+DWL G + A +G PSTP + QT S SQ SKA V SGNGF
Sbjct: 217 PTSNISTDWLGGKSSLAISGP----PSTPNVTLQSQTQFSMPSQPSATDSKASVVSGNGF 272
Query: 288 ASDSVFGGDVFSAITTSPKQGPSSSAYSASTSPTSSANVP-VSGAAQPSSKPYPLNSLQS 346
A+ S FG DVFSA ++ +Q PS YS+S++P S+ VP +SG S K L+SLQS
Sbjct: 273 ATGSSFGADVFSATPSTRRQEPSLPLYSSSSAPASATMVPAMSGGL--SVKSNSLDSLQS 330
Query: 347 AFSMQPAGSQIPQNQ-LSLNPGQKISSQSSSFASAGISVGSGNSTPDNSQVPWPKMKPSD 405
A++MQP G Q+ + Q L + Q +S SSS AS ISVG GNS+ DNSQ PWPKMKPSD
Sbjct: 331 AYAMQPLGGQLQRTQSLPTSGQQVSTSVSSSVASPSISVGVGNSS-DNSQPPWPKMKPSD 389
Query: 406 IQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDSMLSLREFCF 465
+QKY+KVFMEVDTDRDGRITGEQARNLF+SWRLPREVLKQVWDLSDQDSDSMLSLREFCF
Sbjct: 390 VQKYTKVFMEVDTDRDGRITGEQARNLFLSWRLPREVLKQVWDLSDQDSDSMLSLREFCF 449
Query: 466 ALYLMERYREGRPLPAVLPRNVMFDETLLSMTSQPPNAGYGNAAWGPGPGFGPQQVMRPQ 525
ALYLMERYREG LPA LP ++MFDETLLSMT QP +GNAAWGP PGFG Q M +
Sbjct: 450 ALYLMERYREGLRLPASLPSSIMFDETLLSMTGQP-KLIHGNAAWGPNPGFGQQPGMGAR 508
Query: 526 AMTPAGALRPPNLPTHPTADGARMLNQQKPRAPVLDDNLANQLDNGEYSADSKLQDSTTA 585
+M PA LRPP + D + NQQKPRAP L+D+ NQ D G +S D T +
Sbjct: 509 SMAPATGLRPP-VQVAAQPDSVLISNQQKPRAPALEDSFLNQSDTG--GQNSMQTDGTAS 565
Query: 586 GKKVDEREKVILDSREKIEFYRSKMQELVLYKSRCDNRLNEITERALADRREAETLGKKY 645
KV E EKVILDS+EKIEFYRSKMQ+LVLYKSRCDNRLNEITERALAD+REAE LGKKY
Sbjct: 566 ENKVGESEKVILDSKEKIEFYRSKMQDLVLYKSRCDNRLNEITERALADKREAEILGKKY 625
Query: 646 EEKYKQVAEIASKLTIEDAKFRELQERKMELHQAIVNMERGGSADGLLQVRADRIQSDLE 705
EEKYKQVAE+ASKLTIE+A FR++QERK EL+QAI+N+E+GGSADG+LQVRADRIQSDL+
Sbjct: 626 EEKYKQVAEVASKLTIEEATFRDIQERKFELNQAIINIEQGGSADGILQVRADRIQSDLD 685
Query: 706 ELLKALTERCKKHGIDVKSHAVIELPFGWQPGIQEGAGVWDEDWDKFEDAGFGNEITFDV 765
ELL+ L ERCKKHG++ KS A+IELPFGWQPGIQEGA VWDE+WDKFED GF N++T DV
Sbjct: 686 ELLRVLIERCKKHGLEFKSTAMIELPFGWQPGIQEGAAVWDEEWDKFEDEGFANDLTIDV 745
Query: 766 KNASASPNTNSSVQMENTSPDGSPSADNFANVDERQRELMNAGERAFESESAYTHSEDES 825
KN SAS N+ S+VQ E S DGS + D+ +N + E A ESESAY HSEDE
Sbjct: 746 KNVSAS-NSKSTVQKEKGSQDGSLTPDSLSN-GGGNANFFSTSEHALESESAYGHSEDEL 803
Query: 826 ARSPHDSPAGKAAPESPSQNFSDVF-RSSEADAETHRSFDDSTWGAFD-NDDTDSVWGFN 883
ARSP S G+ A ESPSQ FSDVF +S++ADAETHRSFD+STWGAFD +D+TDSVWGFN
Sbjct: 804 ARSPQGSSTGRTALESPSQAFSDVFAKSTDADAETHRSFDESTWGAFDTHDETDSVWGFN 863
Query: 884 TKIYFSPMFDAIFQGSNSDKNRDFFGSSNFGGSPIRTESPTADSTFHKKSPFRFDDSVPS 943
A + S+SDK+RD FG+ +FG PIRT SP DS FHKKSPF F+DSV
Sbjct: 864 P---------ASTKESDSDKHRDIFGTDDFGVKPIRTGSPPLDSFFHKKSPF-FEDSVAG 913
Query: 944 TPLSRFGNSPPRYSEASSDHFDSFSRFDSFNVHDSGFSSHPERLTRFDSMNSTNDFG 1000
+P+SRFGNS PRYSEA DH D+FSRF+SFN+H+ GFS ERL RFDS+NS+ DFG
Sbjct: 914 SPVSRFGNS-PRYSEA-GDHADNFSRFESFNMHEGGFSPR-ERLARFDSINSSKDFG 967
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449485088|ref|XP_004157066.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101204624 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356517259|ref|XP_003527306.1| PREDICTED: uncharacterized protein LOC100784075 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449455615|ref|XP_004145548.1| PREDICTED: uncharacterized protein LOC101204624 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224065677|ref|XP_002301916.1| predicted protein [Populus trichocarpa] gi|222843642|gb|EEE81189.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356508604|ref|XP_003523045.1| PREDICTED: uncharacterized protein LOC100818930 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297745569|emb|CBI40734.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359491847|ref|XP_002272793.2| PREDICTED: uncharacterized protein LOC100240982 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15218021|ref|NP_173499.1| calcium-binding EF hand-containing protein [Arabidopsis thaliana] gi|8886934|gb|AAF80620.1|AC069251_13 F2D10.25 [Arabidopsis thaliana] gi|110742187|dbj|BAE99021.1| hypothetical protein [Arabidopsis thaliana] gi|332191898|gb|AEE30019.1| calcium-binding EF hand-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297845052|ref|XP_002890407.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] gi|297336249|gb|EFH66666.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1123 | ||||||
| TAIR|locus:2030432 | 1019 | AT1G20760 [Arabidopsis thalian | 0.802 | 0.884 | 0.433 | 3.8e-172 | |
| ZFIN|ZDB-GENE-060503-274 | 915 | eps15l1a "epidermal growth fac | 0.446 | 0.547 | 0.233 | 1.1e-22 | |
| UNIPROTKB|F1NLF0 | 919 | EPS15 "Uncharacterized protein | 0.091 | 0.112 | 0.321 | 9.8e-22 | |
| UNIPROTKB|E1C8N9 | 921 | EPS15 "Uncharacterized protein | 0.091 | 0.111 | 0.321 | 9.9e-22 | |
| UNIPROTKB|A7MB30 | 797 | EPS15L1 "Uncharacterized prote | 0.081 | 0.114 | 0.343 | 2.7e-21 | |
| MGI|MGI:104583 | 897 | Eps15 "epidermal growth factor | 0.081 | 0.101 | 0.323 | 1.6e-20 | |
| UNIPROTKB|A5D7I1 | 910 | EPS15 "EPS15 protein" [Bos tau | 0.099 | 0.123 | 0.314 | 2.1e-20 | |
| UNIPROTKB|P42566 | 896 | EPS15 "Epidermal growth factor | 0.099 | 0.125 | 0.314 | 2.3e-20 | |
| RGD|1305550 | 792 | Eps15 "epidermal growth factor | 0.091 | 0.130 | 0.303 | 6.2e-20 | |
| ASPGD|ASPL0000061296 | 1258 | AN0317 [Emericella nidulans (t | 0.227 | 0.202 | 0.302 | 2.4e-15 |
| TAIR|locus:2030432 AT1G20760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1673 (594.0 bits), Expect = 3.8e-172, P = 3.8e-172
Identities = 434/1001 (43%), Positives = 536/1001 (53%)
Query: 112 NSTAAVSVPQMSVPTQMAPQ--NFGFRGPGAPNVSQVQ-QQSIRPYQAAPHPTQGSVGPD 168
NS V+V Q + P+ N P A + + S P P+P +VGP
Sbjct: 67 NSLRLVTVAQSK--RDLTPEIVNAALNTPAAAKIPPPKINLSAIP-APRPNPAATTVGPV 123
Query: 169 FSRGG-----SVMGQTQVMPGSTAP-RPPQTMPAGTAPRP---PQSMPASTS----PHPP 215
GG +++ Q P RP Q + T+ RP P+ P++ S P P
Sbjct: 124 SGFGGPGAPNAIVNQNYFPPQQNQQMRPNQGISGLTSLRPAAGPEYRPSALSGQFQPVPV 183
Query: 216 QSMPESTAGLNVPNSNISSDWLXXXXXXXXXXXXXISPSTPLMPTNPQTPVSSSSQLINN 275
S+ + S S S+ + P Q +
Sbjct: 184 GSVTHPPQPVPTSVSGPGSSTFNLNSLYAGAGNTS-GYSSGFGGGSLAAPSPGLKQESHI 242
Query: 276 KSKALVPSGNGFASDSVFGGDVFSAITTSPKQGXXXXXXXXXXXXXXXXXXXXXGAAQPS 335
KALV SGNG GD+FS+ KQ QP
Sbjct: 243 DPKALVVSGNG--------GDMFSSF--QQKQ-----EPTLSNSSISSAIVPTSAGIQPP 287
Query: 336 SKPYPLNSLQSAFSMQPAGSQI--PQNQLSLNPXXXXXXXXXXXXXXXXXXXXXNSTPDN 393
+KP L+SLQS FSM P+G+Q+ P+ S P ++ N
Sbjct: 288 TKPNALDSLQSTFSMLPSGNQLQQPRPAASSQPAVSSQGPSSGLPPGSAVGSGHSTPAGN 347
Query: 394 SQVPWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWXXXXXX 453
+Q PWPKMKPSD+QKY+KVFMEVD+D+DG+ITGEQARNLF+SWRLPREVLK VW
Sbjct: 348 NQPPWPKMKPSDVQKYTKVFMEVDSDKDGKITGEQARNLFLSWRLPREVLKHVWELSDQD 407
Query: 454 XXXXXXXREFCFALYLMERYREGRPLPAVLPRNVMFDETLLSMTSQPPNAGYGNAAWGPG 513
REFC +LYLMERYREGRPLP LP ++MFDETLLS++ P + GY NA WG G
Sbjct: 408 NDTMLSLREFCISLYLMERYREGRPLPTALPSSIMFDETLLSISGAPSH-GYANAGWGSG 466
Query: 514 PGFGPQQVMRPQAMTPAGALRPPNLPTHPTADGARMLNQQKPRAPVLDDNLANQLDNGEY 573
GF Q M + +TP +RPP P NQ + +APVLD AN L NG Y
Sbjct: 467 QGFVQQPGMGARPITPTTGMRPPVPAPGPQPGSGIPPNQPRNQAPVLDAPFANHLGNG-Y 525
Query: 574 SADSKLQDSTTAGKKVDEREKVILDSREKIEFYRSKMQELVLYKSRCDNRLNEITERALA 633
SA S L ++ +KVDE++ +DSREK+++YR+KMQ++VLYKSRCDNRLNEI+ERA A
Sbjct: 526 SASSNLPEAAADEEKVDEKQNAYMDSREKLDYYRTKMQDIVLYKSRCDNRLNEISERASA 585
Query: 634 DRREAETLGKKYEEKYKQVAEIASKLTIEDAKFRELQERKMELHQAIVNMERGGSADGLL 693
D+REAETL KKYEEKYKQVAEI SKLTIE+A+FRE++ RKMEL QAIVNME+GGSADGLL
Sbjct: 586 DKREAETLAKKYEEKYKQVAEIGSKLTIEEARFREIEGRKMELSQAIVNMEQGGSADGLL 645
Query: 694 QVRADRIQSDLEELLKALTERCKKHGIDVKSHAVIELPFGWQPGIQEGAGVWDEDWDKFE 753
QVRADRIQSDLEEL+KALTERCKKHG++V S A+++LP GWQPGIQEGA +WDE+WDKFE
Sbjct: 646 QVRADRIQSDLEELMKALTERCKKHGLEVNSKALVDLPAGWQPGIQEGAALWDEEWDKFE 705
Query: 754 DAGFGNEITFDVKNASASPNTNSSVQMEN-TSPDGSPSADNFANVDERQRELMNAGERAF 812
D GFGNEITFD S NSS + EN T DGS D+ +V++ +R
Sbjct: 706 DEGFGNEITFD-----KSKEQNSSGEKENGTVDDGSGPPDSPTHVEDNYGPFSETSDRHH 760
Query: 813 ESESAYTHSEDESARSPHDSPAGKAAPESPSQNFSDVFRSSEADAETHRSFDDSTWG-AF 871
ESE THSED RSP DSP + A E PS ++S ++SE FDDS W AF
Sbjct: 761 ESEYGTTHSED---RSPRDSPVSRNATEVPSPDYSQG-KNSEF-------FDDSNWASAF 809
Query: 872 D-NDDTDSVWGFNTKI-----YFSPMFDAIFQGS----NSDKNRDF---------FGSS- 911
D NDD DSVWGF+ YF D F G+ +S +R F F S
Sbjct: 810 DTNDDVDSVWGFDASKSQDGDYFGSGDD--FGGNTARADSPSSRSFGAQRKSQFAFDDSV 867
Query: 912 ------NFGGSPIRTESPTA-DSTFHKKSPFRFDDSVPSTPLSRFGNSPPRYSEAXXXXX 964
FG SP R +A D+ F S RFD S + F + P R S
Sbjct: 868 PSTPLSRFGNSPPRFSDASARDNNFDSFS--RFDSFNTSEAGAGFSSQPERLSRFDSINS 925
Query: 965 XXXXXXXXXNVHDSGFSSHP----ERLTRFDSMNSTNDFGPFSSQPEKVSRFDSMNSSKD 1020
+ DS SS E+ +RFDS+NS+ DFG S +SRFDSMNS+KD
Sbjct: 926 SKDFGGAAFSRFDSINSSRDVTGAEKFSRFDSINSSKDFGGPS-----LSRFDSMNSTKD 980
Query: 1021 FGPFSSQPEKFSRFDSMSSTSDFGHFSSQTEKFSRFDSMNS 1061
F S F D ST F SS R D+ NS
Sbjct: 981 FS--GSHGYSFDDADPFGSTGPF-KVSSDESPTKRSDNWNS 1018
|
|
| ZFIN|ZDB-GENE-060503-274 eps15l1a "epidermal growth factor receptor pathway substrate 15-like 1a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLF0 EPS15 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C8N9 EPS15 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7MB30 EPS15L1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:104583 Eps15 "epidermal growth factor receptor pathway substrate 15" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5D7I1 EPS15 "EPS15 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P42566 EPS15 "Epidermal growth factor receptor substrate 15" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1305550 Eps15 "epidermal growth factor receptor pathway substrate 15" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000061296 AN0317 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | fgenesh4_pm.C_LG_II000036 | hypothetical protein (933 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1123 | |||
| smart00027 | 96 | smart00027, EH, Eps15 homology domain | 3e-24 | |
| cd00052 | 67 | cd00052, EH, Eps15 homology domain; found in prote | 5e-22 | |
| cd00052 | 67 | cd00052, EH, Eps15 homology domain; found in prote | 9e-22 | |
| smart00027 | 96 | smart00027, EH, Eps15 homology domain | 5e-14 | |
| pfam12763 | 104 | pfam12763, efhand_3, Cytoskeletal-regulatory compl | 5e-11 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 7e-07 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 2e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-05 | |
| pfam13499 | 60 | pfam13499, EF_hand_5, EF-hand domain pair | 6e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-04 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 3e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-04 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 5e-04 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 8e-04 | |
| pfam13499 | 60 | pfam13499, EF_hand_5, EF-hand domain pair | 9e-04 | |
| pfam12004 | 489 | pfam12004, DUF3498, Domain of unknown function (DU | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.002 | |
| COG1340 | 294 | COG1340, COG1340, Uncharacterized archaeal coiled- | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.003 | |
| COG1340 | 294 | COG1340, COG1340, Uncharacterized archaeal coiled- | 0.003 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 0.003 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.004 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.004 |
| >gnl|CDD|197477 smart00027, EH, Eps15 homology domain | Back alignment and domain information |
|---|
Score = 97.7 bits (244), Expect = 3e-24
Identities = 34/88 (38%), Positives = 55/88 (62%), Gaps = 1/88 (1%)
Query: 397 PWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDS 456
PW + P D KY ++F +D ++DG +TG QA+ + + LP+ +L ++W+L+D D+D
Sbjct: 1 PWA-ISPEDKAKYEQIFRSLDKNQDGTVTGAQAKPILLKSGLPQTLLAKIWNLADIDNDG 59
Query: 457 MLSLREFCFALYLMERYREGRPLPAVLP 484
L EF A++L+ R G P+PA LP
Sbjct: 60 ELDKDEFALAMHLIYRKLNGYPIPASLP 87
|
Pair of EF hand motifs that recognise proteins containing Asn-Pro-Phe (NPF) sequences. Length = 96 |
| >gnl|CDD|238009 cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >gnl|CDD|238009 cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >gnl|CDD|197477 smart00027, EH, Eps15 homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|193239 pfam12763, efhand_3, Cytoskeletal-regulatory complex EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|221371 pfam12004, DUF3498, Domain of unknown function (DUF3498) | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1123 | |||
| KOG0998 | 847 | consensus Synaptic vesicle protein EHS-1 and relat | 100.0 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 100.0 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 99.9 | |
| KOG0998 | 847 | consensus Synaptic vesicle protein EHS-1 and relat | 99.88 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 99.86 | |
| KOG1955 | 737 | consensus Ral-GTPase effector RALBP1 [Intracellula | 99.8 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 99.71 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 99.67 | |
| PF12761 | 195 | End3: Actin cytoskeleton-regulatory complex protei | 99.63 | |
| KOG1954 | 532 | consensus Endocytosis/signaling protein EHD1 [Sign | 99.46 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 99.23 | |
| KOG1955 | 737 | consensus Ral-GTPase effector RALBP1 [Intracellula | 99.22 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 99.02 | |
| KOG1954 | 532 | consensus Endocytosis/signaling protein EHD1 [Sign | 98.97 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 98.96 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.87 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 98.64 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 98.61 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 98.41 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 98.32 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 98.29 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 98.27 | |
| PTZ00183 | 158 | centrin; Provisional | 98.18 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 98.15 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 98.14 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 98.13 | |
| PTZ00184 | 149 | calmodulin; Provisional | 98.11 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 98.11 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 98.1 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 98.07 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 98.05 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 98.05 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 98.05 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 98.05 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 98.02 | |
| PRK09039 | 343 | hypothetical protein; Validated | 98.02 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 97.99 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 97.98 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 97.97 | |
| PTZ00183 | 158 | centrin; Provisional | 97.94 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 97.93 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 97.92 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 97.91 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 97.89 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.87 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 97.85 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 97.83 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.81 | |
| PTZ00184 | 149 | calmodulin; Provisional | 97.79 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 97.76 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.74 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 97.72 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 97.7 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.68 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 97.67 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 97.65 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.62 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.62 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 97.57 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 97.57 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 97.46 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 97.37 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 97.37 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.37 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 97.35 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.31 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 97.31 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.3 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.25 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 97.24 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 97.23 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.22 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 97.22 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 97.21 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 97.19 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.18 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.18 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 97.16 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.14 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.13 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.12 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.11 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.1 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 97.06 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.03 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 97.0 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 96.97 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 96.95 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 96.94 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 96.93 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 96.93 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.88 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 96.87 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 96.87 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 96.86 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 96.84 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.84 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 96.83 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 96.82 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 96.81 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 96.81 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 96.8 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.79 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 96.77 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.77 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 96.71 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 96.71 | |
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 96.7 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 96.67 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 96.67 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 96.66 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 96.65 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 96.65 | |
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 96.64 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 96.59 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.57 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 96.57 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 96.56 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 96.54 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 96.54 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 96.54 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 96.52 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 96.5 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 96.5 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 96.49 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 96.46 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 96.46 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 96.45 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 96.45 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 96.45 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 96.44 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 96.44 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 96.42 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 96.41 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 96.41 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 96.39 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 96.38 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 96.37 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 96.35 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 96.34 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 96.33 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 96.28 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 96.26 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 96.23 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 96.22 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 96.2 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 96.16 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 96.14 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 96.14 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 96.14 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 96.13 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 96.13 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 96.09 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.09 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 96.07 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 96.07 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 96.07 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 96.05 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 96.05 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 96.04 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 96.03 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 96.02 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 96.01 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 96.0 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 95.99 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 95.97 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 95.96 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 95.95 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 95.94 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 95.91 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 95.9 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 95.89 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 95.88 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 95.88 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 95.87 | |
| KOG0046 | 627 | consensus Ca2+-binding actin-bundling protein (fim | 95.86 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 95.81 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 95.77 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 95.77 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 95.73 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 95.73 | |
| PF09602 | 165 | PhaP_Bmeg: Polyhydroxyalkanoic acid inclusion prot | 95.72 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 95.72 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 95.69 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 95.67 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 95.65 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 95.65 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 95.65 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 95.62 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 95.6 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 95.59 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 95.58 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 95.53 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 95.49 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 95.45 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 95.45 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 95.44 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 95.43 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 95.43 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 95.39 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 95.39 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 95.39 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 95.38 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 95.36 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 95.35 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 95.33 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 95.33 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 95.31 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 95.28 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 95.27 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 95.26 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 95.26 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 95.25 | |
| KOG0030 | 152 | consensus Myosin essential light chain, EF-Hand pr | 95.24 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 95.21 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 95.2 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 95.18 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 95.16 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 95.15 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 95.13 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 95.12 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 95.1 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 95.1 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 95.09 | |
| KOG4223 | 325 | consensus Reticulocalbin, calumenin, DNA supercoil | 95.07 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 95.06 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 95.04 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 95.04 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 95.01 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 94.98 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 94.96 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 94.95 | |
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 94.94 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 94.94 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 94.93 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 94.85 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 94.85 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 94.84 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 94.84 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 94.82 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 94.8 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 94.73 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 94.73 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 94.7 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 94.63 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 94.59 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 94.58 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 94.58 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 94.57 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 94.54 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 94.53 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 94.53 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 94.53 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 94.49 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 94.47 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 94.46 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 94.45 | |
| PF13514 | 1111 | AAA_27: AAA domain | 94.4 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 94.37 | |
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 94.36 | |
| PF13805 | 271 | Pil1: Eisosome component PIL1; PDB: 3PLT_B. | 94.33 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 94.28 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 94.27 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 94.27 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 94.25 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 94.25 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 94.22 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 94.22 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 94.19 | |
| PF07851 | 330 | TMPIT: TMPIT-like protein; InterPro: IPR012926 A n | 94.18 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 94.16 | |
| smart00502 | 127 | BBC B-Box C-terminal domain. Coiled coil region C- | 94.15 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 94.14 | |
| KOG0040 | 2399 | consensus Ca2+-binding actin-bundling protein (spe | 94.13 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 94.12 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 94.12 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 94.11 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 94.07 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 94.04 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 94.04 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 94.03 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 94.0 | |
| PF13514 | 1111 | AAA_27: AAA domain | 93.96 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 93.95 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 93.93 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 93.93 | |
| PF02050 | 123 | FliJ: Flagellar FliJ protein; InterPro: IPR012823 | 93.87 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 93.87 | |
| PF15556 | 252 | Zwint: ZW10 interactor | 93.8 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 93.78 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 93.77 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 93.7 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 93.7 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 93.69 | |
| PF13166 | 712 | AAA_13: AAA domain | 93.66 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 93.62 | |
| KOG0030 | 152 | consensus Myosin essential light chain, EF-Hand pr | 93.62 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 93.6 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 93.6 | |
| PRK00286 | 438 | xseA exodeoxyribonuclease VII large subunit; Revie | 93.59 | |
| KOG1655 | 218 | consensus Protein involved in vacuolar protein sor | 93.58 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 93.58 | |
| cd00176 | 213 | SPEC Spectrin repeats, found in several proteins i | 93.56 | |
| PTZ00464 | 211 | SNF-7-like protein; Provisional | 93.56 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 93.55 | |
| KOG2196 | 254 | consensus Nuclear porin [Nuclear structure] | 93.55 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 93.54 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 93.53 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 93.53 | |
| PF15272 | 196 | BBP1_C: Spindle pole body component BBP1, C-termin | 93.51 | |
| TIGR02132 | 189 | phaR_Bmeg polyhydroxyalkanoic acid synthase, PhaR | 93.51 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 93.5 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 93.47 | |
| PF14073 | 178 | Cep57_CLD: Centrosome localisation domain of Cep57 | 93.46 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 93.42 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 93.42 | |
| KOG0038 | 189 | consensus Ca2+-binding kinase interacting protein | 93.41 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 93.4 | |
| PF09731 | 582 | Mitofilin: Mitochondrial inner membrane protein; I | 93.39 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 93.37 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 93.35 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 93.34 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 93.29 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 93.26 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 93.25 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 93.24 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 93.22 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 93.2 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 93.14 | |
| PF08702 | 146 | Fib_alpha: Fibrinogen alpha/beta chain family; Int | 93.11 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 93.09 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 93.07 | |
| PF02994 | 370 | Transposase_22: L1 transposable element; InterPro: | 93.07 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 93.03 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 93.03 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 93.03 | |
| KOG3091 | 508 | consensus Nuclear pore complex, p54 component (sc | 93.03 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 93.02 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 93.01 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 93.01 | |
| TIGR00020 | 364 | prfB peptide chain release factor 2. In many but n | 93.0 | |
| KOG2891 | 445 | consensus Surface glycoprotein [General function p | 93.0 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 92.99 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 92.99 | |
| PF12252 | 1439 | SidE: Dot/Icm substrate protein; InterPro: IPR0210 | 92.95 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 92.94 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 92.86 | |
| PF08172 | 248 | CASP_C: CASP C terminal; InterPro: IPR012955 This | 92.84 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 92.84 | |
| PF13166 | 712 | AAA_13: AAA domain | 92.82 | |
| KOG4637 | 464 | consensus Adaptor for phosphoinositide 3-kinase [S | 92.76 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 92.76 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 92.72 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 92.68 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 92.68 | |
| PF12072 | 201 | DUF3552: Domain of unknown function (DUF3552); Int | 92.67 | |
| PF00015 | 213 | MCPsignal: Methyl-accepting chemotaxis protein (MC | 92.67 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 92.64 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 92.63 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 92.63 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 92.63 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 92.62 | |
| PF06721 | 228 | DUF1204: Protein of unknown function (DUF1204); In | 92.61 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 92.59 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 92.56 | |
| PF00015 | 213 | MCPsignal: Methyl-accepting chemotaxis protein (MC | 92.51 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 92.5 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 92.48 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 92.48 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 92.46 | |
| PTZ00446 | 191 | vacuolar sorting protein SNF7-like; Provisional | 92.46 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 92.44 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 92.41 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 92.4 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 92.39 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 92.36 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 92.35 | |
| PRK00578 | 367 | prfB peptide chain release factor 2; Validated | 92.35 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 92.34 | |
| cd00176 | 213 | SPEC Spectrin repeats, found in several proteins i | 92.33 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 92.33 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 92.27 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 92.26 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 92.23 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 92.23 | |
| KOG4572 | 1424 | consensus Predicted DNA-binding transcription fact | 92.21 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 92.19 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 92.16 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 92.14 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 92.11 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 92.11 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 92.09 | |
| PF10046 | 99 | BLOC1_2: Biogenesis of lysosome-related organelles | 92.06 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 92.05 | |
| PF04949 | 159 | Transcrip_act: Transcriptional activator; InterPro | 92.04 | |
| TIGR00237 | 432 | xseA exodeoxyribonuclease VII, large subunit. This | 92.0 | |
| KOG4223 | 325 | consensus Reticulocalbin, calumenin, DNA supercoil | 91.96 | |
| PF15456 | 124 | Uds1: Up-regulated During Septation | 91.94 | |
| PF08702 | 146 | Fib_alpha: Fibrinogen alpha/beta chain family; Int | 91.9 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 91.89 | |
| PF00435 | 105 | Spectrin: Spectrin repeat; InterPro: IPR002017 Spe | 91.87 | |
| KOG1850 | 391 | consensus Myosin-like coiled-coil protein [Cytoske | 91.87 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 91.83 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 91.82 | |
| KOG3647 | 338 | consensus Predicted coiled-coil protein [General f | 91.8 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 91.79 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 91.75 | |
| KOG3850 | 455 | consensus Predicted membrane protein [Function unk | 91.73 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 91.73 | |
| KOG4460 | 741 | consensus Nuclear pore complex, Nup88/rNup84 compo | 91.72 | |
| TIGR01541 | 332 | tape_meas_lam_C phage tail tape measure protein, l | 91.7 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 91.62 | |
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 91.54 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 91.48 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 91.45 | |
| KOG0972 | 384 | consensus Huntingtin interacting protein 1 (Hip1) | 91.45 | |
| PF06248 | 593 | Zw10: Centromere/kinetochore Zw10; InterPro: IPR00 | 91.45 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 91.44 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 91.4 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 91.38 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 91.31 | |
| PF08581 | 79 | Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t | 91.31 | |
| KOG4251 | 362 | consensus Calcium binding protein [General functio | 91.27 | |
| KOG0046 | 627 | consensus Ca2+-binding actin-bundling protein (fim | 91.27 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 91.26 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 91.25 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 91.21 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 91.19 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 91.16 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 91.14 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 91.09 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 91.06 | |
| PF11180 | 192 | DUF2968: Protein of unknown function (DUF2968); In | 91.04 | |
| TIGR02473 | 141 | flagell_FliJ flagellar export protein FliJ. Member | 91.01 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 90.91 | |
| KOG4657 | 246 | consensus Uncharacterized conserved protein [Funct | 90.89 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 90.89 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 90.84 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 90.83 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 90.77 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 90.72 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 90.69 | |
| KOG4460 | 741 | consensus Nuclear pore complex, Nup88/rNup84 compo | 90.65 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 90.64 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 90.63 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 90.6 | |
| PF15450 | 531 | DUF4631: Domain of unknown function (DUF4631) | 90.52 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 90.5 | |
| cd07651 | 236 | F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology | 90.46 | |
| PF13863 | 126 | DUF4200: Domain of unknown function (DUF4200) | 90.46 | |
| smart00502 | 127 | BBC B-Box C-terminal domain. Coiled coil region C- | 90.44 | |
| PF08581 | 79 | Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t | 90.42 | |
| KOG4251 | 362 | consensus Calcium binding protein [General functio | 90.37 | |
| cd07627 | 216 | BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of | 90.31 | |
| COG1730 | 145 | GIM5 Predicted prefoldin, molecular chaperone impl | 90.3 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 90.29 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 90.28 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 90.24 | |
| KOG4065 | 144 | consensus Uncharacterized conserved protein [Funct | 90.23 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 90.23 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 90.21 | |
| COG5293 | 591 | Predicted ATPase [General function prediction only | 90.18 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 90.18 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 90.15 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 90.14 | |
| KOG0040 | 2399 | consensus Ca2+-binding actin-bundling protein (spe | 90.12 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 90.11 | |
| KOG2685 | 421 | consensus Cystoskeletal protein Tektin [Cytoskelet | 90.08 | |
| KOG4571 | 294 | consensus Activating transcription factor 4 [Trans | 90.02 | |
| PF04949 | 159 | Transcrip_act: Transcriptional activator; InterPro | 90.0 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 89.98 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 89.95 | |
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 89.94 | |
| KOG3156 | 220 | consensus Uncharacterized membrane protein [Functi | 89.92 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 89.78 | |
| PF04871 | 136 | Uso1_p115_C: Uso1 / p115 like vesicle tethering pr | 89.77 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 89.73 | |
| smart00503 | 117 | SynN Syntaxin N-terminal domain. Three-helix domai | 89.71 | |
| KOG1850 | 391 | consensus Myosin-like coiled-coil protein [Cytoske | 89.64 | |
| PF05546 | 207 | She9_MDM33: She9 / Mdm33 family; InterPro: IPR0088 | 89.64 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 89.5 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 89.49 | |
| PF04740 | 204 | LXG: LXG domain of WXG superfamily; InterPro: IPR0 | 89.46 | |
| PF02841 | 297 | GBP_C: Guanylate-binding protein, C-terminal domai | 89.38 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 89.36 | |
| cd07596 | 218 | BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of So | 89.36 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 89.35 | |
| PRK05689 | 147 | fliJ flagellar biosynthesis chaperone; Validated | 89.34 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 89.32 | |
| cd07653 | 251 | F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B | 89.31 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 89.19 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 89.17 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 89.02 | |
| PF01920 | 106 | Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 | 88.99 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 88.95 | |
| PF10158 | 131 | LOH1CR12: Tumour suppressor protein; InterPro: IPR | 88.92 | |
| PF13805 | 271 | Pil1: Eisosome component PIL1; PDB: 3PLT_B. | 88.91 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 88.88 | |
| PF09486 | 158 | HrpB7: Bacterial type III secretion protein (HrpB7 | 88.87 | |
| PF06810 | 155 | Phage_GP20: Phage minor structural protein GP20; I | 88.86 |
| >KOG0998 consensus Synaptic vesicle protein EHS-1 and related EH domain proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.7e-47 Score=460.52 Aligned_cols=814 Identities=26% Similarity=0.322 Sum_probs=456.1
Q ss_pred ccHHHHHHHHHhhCCCCCCcccHHHHHHHHHhCCCCHHHHHHHHHhhcCCCCCCcCHHHHHHHHHHHHHHhcCCCCCHHH
Q 001211 4 PNQDQFESFFRRADLDGDGRISGAEAVAFFQGSNLPKQVLAQIWMHADHNHTSYLGRQEFYNALKLVTVAQSKRELTPDI 83 (1123)
Q Consensus 4 ~~~~~Ye~vF~~lD~DgDGrISG~Ea~~ff~~SGLP~~~LaqIW~LAD~d~DG~Ldr~EF~vAM~LValAQ~G~eLs~~l 83 (1123)
.....|+.+|..+|..++|+|+|.+++.||..+||+..+|.+||.++|..+.|+|++.+||+||+||++||+|++++.+.
T Consensus 8 ~~q~~~~~~~~~~d~~~~G~i~g~~a~~f~~~s~L~~qvl~qiws~~d~~~~g~l~~q~f~~~lrlva~aq~~~~~~~~~ 87 (847)
T KOG0998|consen 8 PGQPLFDQYFKSADPQGDGRITGAEAVAFLSKSGLPDQVLGQIWSLADSSGKGFLNRQGFYAALRLVAQAQSGRELSAKK 87 (847)
T ss_pred CccchHHHhhhccCcccCCcccHHHhhhhhhccccchhhhhccccccccccCCccccccccccchHhhhhhcccCcCccc
Confidence 35689999999999999999999999999999999999999999999999999999999999999999999999998777
Q ss_pred HhhhhcCCCCCCCCCCCcCCCCCccccccCCcccCCCCCCCCCCCCCCCcCCCCCCCCCCccccccccCCCCCCCCCCCC
Q 001211 84 VKAALYGPAATKIPPPQINLSATPAQQINSTAAVSVPQMSVPTQMAPQNFGFRGPGAPNVSQVQQQSIRPYQAAPHPTQG 163 (1123)
Q Consensus 84 L~~~~~g~~~~~iPpP~l~~~~~p~p~~~~~~~~~~~~~~~~~p~~~q~~~~~~~g~~~~~~~~~~~~rp~~~~~~~~~~ 163 (1123)
+ +++...+|+|++.....+.++...+ . + .+..+|....+.
T Consensus 88 ~-----~~~~~~pp~~~~~~~~~~~~~~~~~-~-s-----------------~~~~~p~~~~qe---------------- 127 (847)
T KOG0998|consen 88 V-----LPASAVPPPPKISHDTSPPSRPSSS-T-S-----------------AAPFVPAITPQE---------------- 127 (847)
T ss_pred c-----ccccCCCCCCccCccCCCcccCCCC-C-C-----------------CcccCCCCCHHH----------------
Confidence 5 3445677888777665555554321 0 0 111111111111
Q ss_pred CCCCCCCCCCccccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccCCCCCCCCCCcccccCCCCC
Q 001211 164 SVGPDFSRGGSVMGQTQVMPGSTAPRPPQTMPAGTAPRPPQSMPASTSPHPPQSMPESTAGLNVPNSNISSDWLSGGAGG 243 (1123)
Q Consensus 164 ~~~p~~~~~~~~~g~~~~~~~~~~~~~~~~~p~g~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~s~~~~~~~~g~~~g 243 (1123)
+..++.++++ .. | .++.+.|.++++++++++|+.+|||
T Consensus 128 --------~aky~q~f~s-----------~~-----------------p-~~g~~sg~~~~pil~~s~Lp~~~l~----- 165 (847)
T KOG0998|consen 128 --------QAKYDQIFRS-----------LS-----------------P-SNGLLSGDKAKPILLNSKLPSDVLG----- 165 (847)
T ss_pred --------HHHHHHHHhc-----------cC-----------------C-CCCccccchhhhhhhcCCCChhhhc-----
Confidence 1122333321 01 1 1334567889999999999999998
Q ss_pred CCCCCCcCCCCCCCCCCCCCCCCCCccccccccccccccCCCCCCCCCccccccc---ccccCCCCCCCCCCCCCCCCCC
Q 001211 244 ASTGSRAISPSTPLMPTNPQTPVSSSSQLINNKSKALVPSGNGFASDSVFGGDVF---SAITTSPKQGPSSSAYSASTSP 320 (1123)
Q Consensus 244 ~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~gnG~~s~s~f~~d~f---sA~~~~~~q~p~~~~~~~~~~~ 320 (1123)
++| .+ .+.+.+|.++..+|..+|+ ....- ..+|++.-
T Consensus 166 ---~iw---------------------~l-------~d~d~~g~Ld~~ef~~am~l~~~~l~~--~~~p~P~~------- 205 (847)
T KOG0998|consen 166 ---RIW---------------------EL-------SDIDKDGNLDRDEFAVAMHLINDLLNG--NSEPVPSR------- 205 (847)
T ss_pred ---ccc---------------------cc-------ccccccCCCChhhhhhhhhHHHHHhhc--ccCCCCcc-------
Confidence 666 22 3788999999999999984 33330 01333222
Q ss_pred CCCCccCCCCCCCCCCCCC-Ccchh---------hhhcccCCCCCCCCccccCCCCCCCcccCCCCCCCCCcccCCCCCC
Q 001211 321 TSSANVPVSGAAQPSSKPY-PLNSL---------QSAFSMQPAGSQIPQNQLSLNPGQKISSQSSSFASAGISVGSGNST 390 (1123)
Q Consensus 321 ~ss~~~p~s~~~~p~~~~~-~~~~l---------qs~~~~~p~~~~~~~~q~~~~~~~~~s~~s~~~~~~g~~~g~~~~~ 390 (1123)
.+..+||.++..-.....+ .+..+ +..+.+.+...++. ..++. +- . ....
T Consensus 206 ~p~~lIpps~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~s~~~------------~~~s~----~~---~-~~~~ 265 (847)
T KOG0998|consen 206 LPPSLIPPSKSELSANSSSKAIPFSQPFLASMASPTTLSSLVDLSALN------------SNPSL----SS---L-SLAS 265 (847)
T ss_pred CCcccCCcchhcccccCcccccccccccccccccccccccccchhccc------------CCccc----cc---c-cccc
Confidence 2233344444332111111 01111 11111111111111 11111 11 1 1112
Q ss_pred CCCCCCCC-CCCCHHHHHHHHHHHHhhCCCCCCccCHHHHHHHHHhcCCCHHHHHHHHHhhCCCCCCCcCHHHHHHHHHH
Q 001211 391 PDNSQVPW-PKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDSMLSLREFCFALYL 469 (1123)
Q Consensus 391 s~~~~~~W-p~ISpeDk~kY~~IF~slDkD~DG~ISG~Ear~~F~kSgLP~e~L~qIW~LADiDnDG~LdkdEF~IAMhL 469 (1123)
+.+....| |+|++.++.+|.+||.++|++.+|+|++.+++++|+.+||+...|++||.|+|++++|+|+++|||++|||
T Consensus 266 ~~q~~~s~~~~vsp~d~~~~~~if~q~d~~~dG~I~s~~~~~~f~~~gl~~~~l~~~w~l~d~~n~~~ls~~ef~~~~~~ 345 (847)
T KOG0998|consen 266 SMQLIVSWSPKVSPSDKQKYSKIFSQVDKDNDGSISSNEARNIFLPFGLSKPRLAHVWLLADTQNTGTLSKDEFALAMHL 345 (847)
T ss_pred ccccccccCcccChHHHHHHHHHHHhccccCCCcccccccccccccCCCChhhhhhhhhhcchhccCcccccccchhhhh
Confidence 33556677 68999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHH-hcCCCCCCCCCCCccccccccccCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCcCCCCCCCCCCCCCCCCCCcc
Q 001211 470 MERY-REGRPLPAVLPRNVMFDETLLSMTSQPP-NAGYGNAAWGPGPGFGPQQVMRPQAMTPAGALRPPNLPTHPTADGA 547 (1123)
Q Consensus 470 I~~~-~~G~~LP~~LPpsLipps~~~~~~~qps-~~~y~l~s~q~~p~~qqQ~~~gs~~~~Pts~~~Pp~~~l~~~~~~~ 547 (1123)
+.++ .+|+.||.+||.+|+++..+. +..+. ...++ ++|........+..+....+.+....++.. .+....
T Consensus 346 ~~~~~~~g~~lP~vl~~s~~p~~~~~--~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~----~~~~~~ 418 (847)
T KOG0998|consen 346 LEQKRAEGRSLPSVLPSSLIPSENRK--QTNPTTRASTA-ESPSSEQSSLAELKSLALSIASNPREKPRL----EQSSSE 418 (847)
T ss_pred hhhhhhcCCCCcccccccccCccccc--cCCcccccccc-ccCCcccccccccccccccccccccccccc----cccccc
Confidence 9999 689999999999999996432 11111 00011 122211100001101001000010001100 001111
Q ss_pred cccCCCCCCCCccchhhhccCCccccccccccchhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHH
Q 001211 548 RMLNQQKPRAPVLDDNLANQLDNGEYSADSKLQDSTTAGKKVDEREKVILDSREKIEFYRSKMQELVLYKSRCDNRLNEI 627 (1123)
Q Consensus 548 t~~~~~~ss~P~ld~~l~~dld~ee~~sL~~~qEatdL~keLAnLenQied~~Ek~~~lrsQmQELl~yKsraeqeLne~ 627 (1123)
....++....+++ ++.+.|..++....+......+...++.++.+++++.+++...++++++++..++++|..+|+.+
T Consensus 419 ~~~~~~~~~s~~~--~~~~~l~~~~s~~~~l~~~~~~~~~k~~e~~~~~s~s~~~~~~~~~k~~~~~~~~s~~~~~~~~~ 496 (847)
T KOG0998|consen 419 APRTTPVKTSPVL--ELANELSNLASTSQQLPAQKDTVQDKLNELDAQKSQSKEKFSTTRKKKQEEPQWISSLDNDLNLL 496 (847)
T ss_pred ccccCcccccccc--cchhhhhhcchhhhccccccchhhhhhhhhhhhhhHHHhhhhhhhhhhhccccccccccchhhhc
Confidence 1111111122222 22344554444444433334445577899999999999999999999999999999999999999
Q ss_pred HHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCchhHHHHHHHHHHHHHHH
Q 001211 628 TERALADRREAETLGKKYEEKYKQVAEIASKLTIEDAKFRELQERKMELHQAIVNMERGGSADGLLQVRADRIQSDLEEL 707 (1123)
Q Consensus 628 ~eq~selkreLqsLR~kyEee~KqV~~LEsQLavlEa~LqdiQ~EL~ELeqeLqklq~g~~~n~~Lqer~~~in~el~eL 707 (1123)
..++...+++++++.++|++..+|+..|+..|...+.++..++.+|..|..++...+ ..-+.|..+........++|
T Consensus 497 ~~~~~~~~~ei~~~~~~ln~~~qq~~~l~~~v~~~~~~ve~l~~~L~~~~~~~~~~~---s~~~~l~~~~~~~~~~~~~~ 573 (847)
T KOG0998|consen 497 PLQLSNDNREISSLEKELNELQQQLSVLEGSVKAIESQVENLQKELLDLIYEMADTR---SKSTLLDDSFKVGMELFEQL 573 (847)
T ss_pred ccccccchhhHHHHHHHHhhhHHHHhHHhhhhhhhhhhhhhhHhHHHHHHHHHHhhc---ccchhhhhhhhhhhhhhhhh
Confidence 999998999999999555555555544444444444443333333333333333333 44444444444443333333
Q ss_pred HHHHHHHHHHhCcccccceeeecCCCcCCCcccccccchhhhhhccccCCCccccccccCCCCCCCCCCccccCCCC-CC
Q 001211 708 LKALTERCKKHGIDVKSHAVIELPFGWQPGIQEGAGVWDEDWDKFEDAGFGNEITFDVKNASASPNTNSSVQMENTS-PD 786 (1123)
Q Consensus 708 ~kqL~E~~k~lgvk~k~~~~ielp~gw~~~~~e~a~~w~e~wd~~~d~~f~~~~t~~~~~~~~~~~~~~~~~~~~~~-~~ 786 (1123)
.+.....|.+.+ .-.+.+.+..-||+.| . .|-.+.|+....... .++...+ .|
T Consensus 574 ~~~~k~~n~~~~--~s~~~l~~~~e~~~~~--------~-~~~~~~d~~~~~k~~---------------~~~~~~~~~~ 627 (847)
T KOG0998|consen 574 LKGSKLVNGKDQ--NSSTELAGYLEGTING--------K-GLETSMDDSKEQKNE---------------DDKKSELSTD 627 (847)
T ss_pred hhhhhccccccc--cchhhhhhhccccccc--------c-cccccccchhhcccc---------------cccccccccC
Confidence 333333333333 1222233333344433 0 222222222220000 0011111 12
Q ss_pred CCCCCCCCcchhHh-hhhhhccccccccCCccccCCccccccCCCCCCCCCCCCCCCCCCccccccCCccccccccccCC
Q 001211 787 GSPSADNFANVDER-QRELMNAGERAFESESAYTHSEDESARSPHDSPAGKAAPESPSQNFSDVFRSSEADAETHRSFDD 865 (1123)
Q Consensus 787 ~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~r~p~~s~~~~~~~~s~~~~~~~~~~~~~~d~~~~~~~d~ 865 (1123)
........++++.. +.+. |..........+...|+++-... ++.+|. ..+.+||.
T Consensus 628 ~~~~~~~~~~~~~~~~~~~-------------~~~~~~~~~~t~~~~p~~~~~~~-~~~~~~----------~ss~f~~~ 683 (847)
T KOG0998|consen 628 PEENPDSYSSVPSASRGDP-------------FAGDKNKEETTSSSDPFGGDPVK-ESPKFE----------SSSEFFDA 683 (847)
T ss_pred cccCCcccccccccccCCc-------------cccCchhhhcccccCCccccccc-cCCCcc----------cccccccc
Confidence 11122222222211 1011 11111122234444677766555 555553 23567888
Q ss_pred CCCCCCCCCCCcccccCCcccccCCCccccccCCCCCCCCCCcCCCCCCCCCcccCCCCCCCcccccCCccccCCCCCCc
Q 001211 866 STWGAFDNDDTDSVWGFNTKIYFSPMFDAIFQGSNSDKNRDFFGSSNFGGSPIRTESPTADSTFHKKSPFRFDDSVPSTP 945 (1123)
Q Consensus 866 ~~wg~fd~~d~ds~w~~~~~~~~~~~~~~~~~~~~~~~~~~~f~s~~~~~~p~r~~s~~~~~~~~~~~~f~f~~svp~tp 945 (1123)
.+|-.++... +..|..+..... +.+. +..+..|+..+ ..++.....|+....|.+...|
T Consensus 684 ~~~~~~~~~~-~~~~~~~~~~~~-------~~~~-~~~~~p~~p~~--------~~~t~~~~~~~~~~~~~~~~~~---- 742 (847)
T KOG0998|consen 684 GTPFDKFTSP-DPFPTQSASSPS-------PLEP-FASSDPFPPSS--------ASPTSPSDPFQPVPSFPPQPFV---- 742 (847)
T ss_pred CCccccccCC-CCcccCCCCCCC-------CCcc-cCCCCCCCCCC--------CCCCCcccccccccccCccccC----
Confidence 8887555444 788887744422 1111 11233333322 2222222223332223222222
Q ss_pred ccCCCCCCCCCCcccCCccCccccccccccCCCCCCCCCccccc--ccccccCCCCCCCCCCcccccccccCCCCCCCCC
Q 001211 946 LSRFGNSPPRYSEASSDHFDSFSRFDSFNVHDSGFSSHPERLTR--FDSMNSTNDFGPFSSQPEKVSRFDSMNSSKDFGP 1023 (1123)
Q Consensus 946 ~~~~~~s~p~~~~~~~~~~~~~srfdsf~~~~~~~~~~~~~~sr--fds~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1023 (1123)
.+|..|++|-+=.-.+ -+ ++.++= +++.-.+.+ .+...+..++||+. .++ ++
T Consensus 743 ----------------~~~~d~~~~~~~~~~~--~~--~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~--~~~-~~ 796 (847)
T KOG0998|consen 743 ----------------PEFADFSEFSSANNSE--LF--RDSTSASFEESVIKSEA---TTPADNSDSDGDSV--PQD-PG 796 (847)
T ss_pred ----------------CCCcccccccccCCcc--cc--ccccccccccccccccc---CCcccCcCCCCCCc--cCC-CC
Confidence 1122233332211100 11 011110 222222222 23356777777777 555 32
Q ss_pred CCCCCCcccccccCccCCCCCCCCcccccccccccccccccCCCCcccccccccc
Q 001211 1024 FSSQPEKFSRFDSMSSTSDFGHFSSQTEKFSRFDSMNSARDFGGDKLSRFDSMSS 1078 (1123)
Q Consensus 1024 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1078 (1123)
...++||++.|+..+.. .++|.+|++.||. |+.+-.+.|+++|.+
T Consensus 797 -----~~~s~~~~~~s~~~~~~----~~~f~~~~~~~s~-~~~~~~~~~~~~~~~ 841 (847)
T KOG0998|consen 797 -----GSASAFDSLSSTATPSL----ADKFSPFSSFNSS-DDSSPSLFLPPFSSS 841 (847)
T ss_pred -----cccchhccccccCCccc----cccccccccccCC-cccccccccCccccC
Confidence 66788888888888774 4588888888888 888888888888876
|
|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >KOG0998 consensus Synaptic vesicle protein EHS-1 and related EH domain proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >PF12761 End3: Actin cytoskeleton-regulatory complex protein END3 | Back alignment and domain information |
|---|
| >KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09602 PhaP_Bmeg: Polyhydroxyalkanoic acid inclusion protein (PhaP_Bmeg); InterPro: IPR011728 This entry describes a protein found in polyhydroxyalkanoic acid (PHA) gene regions and incorporated into PHA inclusions in Bacillus cereus and Bacillus megaterium | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >PF13805 Pil1: Eisosome component PIL1; PDB: 3PLT_B | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07851 TMPIT: TMPIT-like protein; InterPro: IPR012926 A number of members of this family are annotated as being transmembrane proteins induced by tumour necrosis factor alpha, but no literature was found to support this | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >smart00502 BBC B-Box C-terminal domain | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF15556 Zwint: ZW10 interactor | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG1655 consensus Protein involved in vacuolar protein sorting [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >PTZ00464 SNF-7-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2196 consensus Nuclear porin [Nuclear structure] | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF15272 BBP1_C: Spindle pole body component BBP1, C-terminal | Back alignment and domain information |
|---|
| >TIGR02132 phaR_Bmeg polyhydroxyalkanoic acid synthase, PhaR subunit | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PF08702 Fib_alpha: Fibrinogen alpha/beta chain family; InterPro: IPR012290 Fibrinogen plays key roles in both blood clotting and platelet aggregation | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00020 prfB peptide chain release factor 2 | Back alignment and domain information |
|---|
| >KOG2891 consensus Surface glycoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF12252 SidE: Dot/Icm substrate protein; InterPro: IPR021014 This entry represents bacterial proteins that are typically between 397 and 1543 amino acids in length including SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >KOG4637 consensus Adaptor for phosphoinositide 3-kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF12072 DUF3552: Domain of unknown function (DUF3552); InterPro: IPR022711 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF00015 MCPsignal: Methyl-accepting chemotaxis protein (MCP) signalling domain; InterPro: IPR004089 Methyl-accepting chemotaxis proteins (MCPs) are a family of bacterial receptors that mediate chemotaxis to diverse signals, responding to changes in the concentration of attractants and repellents in the environment by altering swimming behaviour [] | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF06721 DUF1204: Protein of unknown function (DUF1204); InterPro: IPR009596 This family represents the C terminus of a number of Arabidopsis thaliana hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00015 MCPsignal: Methyl-accepting chemotaxis protein (MCP) signalling domain; InterPro: IPR004089 Methyl-accepting chemotaxis proteins (MCPs) are a family of bacterial receptors that mediate chemotaxis to diverse signals, responding to changes in the concentration of attractants and repellents in the environment by altering swimming behaviour [] | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PTZ00446 vacuolar sorting protein SNF7-like; Provisional | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PRK00578 prfB peptide chain release factor 2; Validated | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF10046 BLOC1_2: Biogenesis of lysosome-related organelles complex-1 subunit 2 ; InterPro: IPR019269 This entry represents a family of proteins that play a role in cellular proliferation, as well as in the biogenesis of specialised organelles of the endosomal-lysosomal system [] | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae [] | Back alignment and domain information |
|---|
| >TIGR00237 xseA exodeoxyribonuclease VII, large subunit | Back alignment and domain information |
|---|
| >KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF15456 Uds1: Up-regulated During Septation | Back alignment and domain information |
|---|
| >PF08702 Fib_alpha: Fibrinogen alpha/beta chain family; InterPro: IPR012290 Fibrinogen plays key roles in both blood clotting and platelet aggregation | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00435 Spectrin: Spectrin repeat; InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure | Back alignment and domain information |
|---|
| >KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG3647 consensus Predicted coiled-coil protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG3850 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR01541 tape_meas_lam_C phage tail tape measure protein, lambda family | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG0972 consensus Huntingtin interacting protein 1 (Hip1) interactor Hippi [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06248 Zw10: Centromere/kinetochore Zw10; InterPro: IPR009361 Zeste white 10 (ZW10) was initially identified as a mitotic checkpoint protein involved in chromosome segregation, and then implicated in targeting cytoplasmic dynein and dynactin to mitotic kinetochores, but it is also important in non-dividing cells | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] | Back alignment and domain information |
|---|
| >KOG4251 consensus Calcium binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function | Back alignment and domain information |
|---|
| >TIGR02473 flagell_FliJ flagellar export protein FliJ | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4657 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF15450 DUF4631: Domain of unknown function (DUF4631) | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins | Back alignment and domain information |
|---|
| >PF13863 DUF4200: Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >smart00502 BBC B-Box C-terminal domain | Back alignment and domain information |
|---|
| >PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] | Back alignment and domain information |
|---|
| >KOG4251 consensus Calcium binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p | Back alignment and domain information |
|---|
| >COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4065 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >COG5293 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4571 consensus Activating transcription factor 4 [Transcription] | Back alignment and domain information |
|---|
| >PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae [] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >KOG3156 consensus Uncharacterized membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PF04871 Uso1_p115_C: Uso1 / p115 like vesicle tethering protein, C terminal region; InterPro: IPR006955 This domain identifies a group of proteins, which are described as: General vesicular transport factor, Transcytosis associate protein (TAP) and Vesicle docking protein | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00503 SynN Syntaxin N-terminal domain | Back alignment and domain information |
|---|
| >KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05546 She9_MDM33: She9 / Mdm33 family; InterPro: IPR008839 Members of this family are mitochondrial inner membrane proteins with a role in inner mitochondrial membrane organisation and biogenesis [] | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >PF04740 LXG: LXG domain of WXG superfamily; InterPro: IPR006829 This group of putative transposases is found in Gram-positive bacteria, mostly Bacillus members and is thought to be a Cytosolic protein | Back alignment and domain information |
|---|
| >PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >cd07596 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK05689 fliJ flagellar biosynthesis chaperone; Validated | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10158 LOH1CR12: Tumour suppressor protein; InterPro: IPR018780 This entry represents a region of 130 amino acids that is the most conserved part of some hypothetical proteins involved in loss of heterozygosity, and thus, tumour suppression [] | Back alignment and domain information |
|---|
| >PF13805 Pil1: Eisosome component PIL1; PDB: 3PLT_B | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF09486 HrpB7: Bacterial type III secretion protein (HrpB7); InterPro: IPR013392 This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia | Back alignment and domain information |
|---|
| >PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1123 | ||||
| 1qjt_A | 99 | Solution Structure Of The Apo Eh1 Domain Of Mouse E | 4e-08 | ||
| 2kgr_A | 111 | Solution Structure Of Protein Itsn1 From Homo Sapie | 2e-06 | ||
| 2khn_A | 121 | Nmr Solution Structure Of The Eh 1 Domain From Huma | 7e-05 | ||
| 2qpt_A | 550 | Crystal Structure Of An Ehd Atpase Involved In Memb | 1e-04 | ||
| 3fia_A | 121 | Crystal Structure Of The Eh 1 Domain From Human Int | 2e-04 | ||
| 1c07_A | 95 | Structure Of The Third Eps15 Homology Domain Of Hum | 4e-04 |
| >pdb|1QJT|A Chain A, Solution Structure Of The Apo Eh1 Domain Of Mouse Epidermal Growth Factor Receptor Substrate 15, Eps15 Length = 99 | Back alignment and structure |
|
| >pdb|2KGR|A Chain A, Solution Structure Of Protein Itsn1 From Homo Sapiens. Northeast Structural Genomics Consortium Target Hr5524a Length = 111 | Back alignment and structure |
| >pdb|2KHN|A Chain A, Nmr Solution Structure Of The Eh 1 Domain From Human Intersectin-1 Protein. Northeast Structural Genomics Consortium Target Hr3646e Length = 121 | Back alignment and structure |
| >pdb|2QPT|A Chain A, Crystal Structure Of An Ehd Atpase Involved In Membrane Remodelling Length = 550 | Back alignment and structure |
| >pdb|3FIA|A Chain A, Crystal Structure Of The Eh 1 Domain From Human Intersectin- 1 Protein. Northeast Structural Genomics Consortium Target Hr3646e Length = 121 | Back alignment and structure |
| >pdb|1C07|A Chain A, Structure Of The Third Eps15 Homology Domain Of Human Eps15 Length = 95 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 | Back alignment and structure |
|---|
Score = 118 bits (298), Expect = 1e-31
Identities = 33/100 (33%), Positives = 46/100 (46%), Gaps = 1/100 (1%)
Query: 385 GSGNSTPDNSQVPWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLK 444
GS PW ++ + Y F + D I+G A+N F +L L
Sbjct: 1 GSLQDNSSYPDEPW-RITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELS 59
Query: 445 QVWDLSDQDSDSMLSLREFCFALYLMERYREGRPLPAVLP 484
+W+LSD D D L+L EFC A +L+ + G PLP LP
Sbjct: 60 YIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGLP 99
|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Length = 139 | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Length = 139 | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1123 | |||
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 99.91 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 99.86 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 99.84 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 99.83 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 99.83 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 99.82 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 99.82 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 99.75 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 99.75 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 99.74 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 99.62 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 99.62 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 99.61 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 99.57 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 99.56 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 99.56 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 99.54 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 99.39 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 99.27 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 99.25 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 99.08 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 99.01 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 98.86 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 98.81 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 98.79 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 98.78 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 98.74 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 98.74 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 98.72 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 98.71 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 98.7 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 98.68 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 98.67 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 98.67 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 98.62 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 98.61 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 98.61 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 98.6 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 98.6 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 98.57 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 98.57 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 98.56 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 98.55 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 98.55 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 98.55 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 98.54 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 98.54 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 98.53 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 98.53 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 98.53 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 98.52 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 98.52 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 98.51 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 98.51 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 98.51 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 98.5 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 98.5 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 98.5 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 98.49 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 98.49 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 98.48 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 98.48 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 98.48 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 98.47 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 98.47 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 98.46 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 98.46 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 98.46 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 98.46 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 98.45 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 98.45 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 98.45 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 98.44 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 98.43 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 98.43 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 98.43 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 98.42 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 98.42 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 98.42 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 98.42 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 98.42 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 98.42 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 98.42 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 98.42 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 98.41 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 98.41 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 98.41 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 98.41 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 98.41 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 98.4 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 98.4 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 98.4 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 98.4 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 98.4 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 98.4 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 98.4 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 98.4 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 98.4 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 98.39 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 98.39 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 98.39 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 98.39 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 98.39 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 98.38 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 98.38 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 98.38 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 98.38 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 98.38 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 98.38 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 98.38 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 98.38 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 98.37 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 98.37 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 98.37 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 98.37 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 98.37 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 98.37 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 98.37 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 98.37 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 98.36 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 98.36 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 98.36 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 98.36 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 98.35 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 98.35 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 98.35 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 98.35 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 98.34 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 98.34 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 98.34 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 98.34 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 98.34 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 98.33 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 98.33 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 98.33 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 98.33 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 98.33 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 98.33 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 98.33 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 98.33 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 98.33 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 98.32 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 98.32 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 98.32 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 98.32 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 98.32 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 98.31 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 98.31 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 98.31 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 98.31 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 98.3 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 98.3 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 98.3 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 98.3 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 98.29 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 98.29 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 98.28 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 98.28 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 98.28 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 98.27 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 98.27 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 98.27 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 98.27 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 98.27 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 98.26 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 98.26 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 98.26 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 98.26 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 98.26 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 98.25 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 98.25 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 98.24 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 98.24 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 98.24 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 98.24 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 98.23 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 98.23 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 98.23 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 98.23 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 98.22 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 98.22 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 98.22 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 98.22 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 98.22 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 98.22 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 98.22 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 98.21 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 98.2 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 98.2 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 98.2 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 98.2 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 98.19 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 98.19 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 98.19 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 98.18 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 98.18 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 98.18 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 98.17 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 98.17 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 98.16 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 98.16 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 98.16 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 98.16 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 98.15 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 98.14 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 98.14 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 98.14 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 98.14 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 98.14 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 98.13 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 98.13 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 98.13 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 98.13 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 98.12 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 98.12 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 98.11 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 98.11 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 98.11 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 98.11 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 98.1 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 98.1 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 98.1 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 98.09 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 98.09 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 98.08 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 98.07 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 98.06 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 98.06 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 98.06 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 98.05 | |
| 3trt_A | 77 | Vimentin; cytoskeleton, intermediate filament, alp | 98.05 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 98.05 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 98.04 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 98.03 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 98.02 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 98.01 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 98.01 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 98.0 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 98.0 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 97.99 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 97.98 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 97.98 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 97.97 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 97.97 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 97.96 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 97.96 | |
| 1x8y_A | 86 | Lamin A/C; structural protein, intermediate filame | 97.96 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 97.94 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 97.94 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 97.94 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 97.94 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 97.94 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 97.93 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 97.93 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 97.93 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 97.93 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 97.92 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 97.92 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 97.92 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 97.9 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 97.9 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 97.9 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 97.89 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 97.89 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 97.88 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 97.88 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 97.88 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 97.87 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 97.86 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 97.86 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 97.85 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 97.85 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 97.85 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 97.85 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 97.84 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 97.84 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 97.84 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 97.82 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 97.82 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 97.81 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 97.81 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 97.81 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 97.81 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.81 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 97.8 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 97.79 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 97.79 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 97.78 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 97.78 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 97.78 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 97.77 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 97.76 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 97.75 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 97.71 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.67 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 97.66 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 97.65 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 97.65 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 97.64 | |
| 3mov_A | 95 | Lamin-B1; LMNB1, B-type lamins, intermediate filam | 97.64 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 97.62 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 97.59 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 97.56 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 97.56 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 97.51 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.51 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.47 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 97.46 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.44 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.37 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 97.37 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 97.36 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 97.36 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 97.34 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 97.33 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 97.24 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.23 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.15 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 97.12 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 97.01 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 97.01 | |
| 1gk6_A | 59 | Vimentin; intermediate filament, dimer, parallel c | 96.99 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 96.98 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 96.98 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 96.95 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.94 | |
| 2xv5_A | 74 | Lamin-A/C; structural protein, intermediate filame | 96.93 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.93 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.88 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 96.86 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 96.85 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 96.78 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 96.67 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 96.65 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 96.61 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 96.55 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 96.48 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 96.47 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 96.36 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 96.3 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 96.18 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 96.17 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 96.13 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 96.13 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 96.02 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 95.87 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 95.8 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 95.79 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 95.72 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 95.65 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 95.45 | |
| 1m1j_A | 491 | Fibrinogen alpha subunit; coiled coils, disulfide | 95.43 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 95.34 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 95.29 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 95.16 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 95.12 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 94.94 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 94.85 | |
| 2xzr_A | 114 | Immunoglobulin-binding protein EIBD; cell adhesion | 94.65 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 94.51 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 94.49 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 94.34 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 94.32 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 94.28 | |
| 2no2_A | 107 | HIP-I, huntingtin-interacting protein 1; clathrin | 94.25 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 94.17 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 94.16 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 93.84 | |
| 1d7m_A | 101 | Cortexillin I; coiled-coil, coiled-coil trigger si | 93.64 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 93.48 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 93.41 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 93.39 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 93.33 | |
| 2xnx_M | 146 | M protein, M1-BC1; cell adhesion, virulence factor | 93.24 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 93.17 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 93.12 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 93.09 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 93.03 | |
| 3l4q_C | 170 | Phosphatidylinositol 3-kinase regulatory subunit b | 92.93 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 92.71 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 92.64 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 92.62 | |
| 1ez3_A | 127 | Syntaxin-1A; three helix bundle, endocytosis/exocy | 92.61 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 92.56 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 92.5 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 92.38 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 92.37 | |
| 1gqe_A | 365 | Release factor 2, RF2; protein synthesis, ribosome | 92.37 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 92.36 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 92.36 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 92.31 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 92.28 | |
| 1fxk_A | 107 | Prefoldin; archaeal protein, chaperone; 2.30A {Met | 92.0 | |
| 3ajw_A | 150 | Flagellar FLIJ protein; flagellum, type III secret | 91.84 | |
| 2jrf_A | 184 | Tubulin polymerization-promoting protein family me | 91.54 | |
| 3uul_A | 118 | Utrophin; spectrin repeat, structural protein, cyt | 91.51 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 91.5 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 91.29 | |
| 2no2_A | 107 | HIP-I, huntingtin-interacting protein 1; clathrin | 91.27 | |
| 1s94_A | 180 | S-syntaxin; three helix bundle, structural plastic | 91.23 | |
| 3thf_A | 190 | Protein shroom; coiled-coil, anti-parallel, helica | 91.23 | |
| 3uun_A | 119 | Dystrophin; triple helical, cell structure and sta | 91.11 | |
| 1fxk_A | 107 | Prefoldin; archaeal protein, chaperone; 2.30A {Met | 91.06 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 91.02 | |
| 3plt_A | 234 | Sphingolipid long chain base-responsive protein L; | 91.01 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 90.62 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 90.52 | |
| 3ghg_B | 461 | Fibrinogen beta chain; triple-stranded coiled coil | 90.38 | |
| 1wlm_A | 151 | Protein CGI-38; structural genomics, NPPSFA, natio | 90.33 | |
| 2v0o_A | 276 | FCHO2, FCH domain only protein 2; lipid-binding pr | 90.1 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 90.08 | |
| 3pdy_A | 210 | Plectin; cytoskeleton, plakin, intermediate filame | 90.06 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 90.04 | |
| 3s84_A | 273 | Apolipoprotein A-IV; four helix bundle, transport | 90.02 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 90.0 | |
| 3kbt_A | 326 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 89.82 | |
| 2efl_A | 305 | Formin-binding protein 1; EFC domain, structural g | 89.79 | |
| 1cun_A | 213 | Protein (alpha spectrin); two repeats of spectrin, | 89.74 | |
| 3etw_A | 119 | Adhesin A; antiparallel helix-loop-helix, leucine | 89.67 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 89.65 | |
| 1s35_A | 214 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 89.65 | |
| 3edv_A | 323 | Spectrin beta chain, brain 1; spectrin repeat, coi | 89.49 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 89.45 | |
| 3f31_A | 149 | Spectrin alpha chain, brain; LONE helix followed b | 89.44 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 89.37 | |
| 1d7m_A | 101 | Cortexillin I; coiled-coil, coiled-coil trigger si | 89.36 | |
| 4emc_A | 190 | Monopolin complex subunit CSM1; RWD domain, kineto | 89.18 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 89.17 | |
| 3mov_A | 95 | Lamin-B1; LMNB1, B-type lamins, intermediate filam | 89.16 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 89.11 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 88.96 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 88.94 | |
| 3ghg_B | 461 | Fibrinogen beta chain; triple-stranded coiled coil | 88.57 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 88.52 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 88.47 | |
| 2efk_A | 301 | CDC42-interacting protein 4; EFC domain, structura | 88.24 | |
| 3lbx_A | 161 | Spectrin alpha chain, erythrocyte; tetramer, compl | 88.23 | |
| 2xdj_A | 83 | Uncharacterized protein YBGF; unknown function; 1. | 88.14 | |
| 2oto_A | 155 | M protein; helical coiled coil, fibrinogen-binding | 88.02 | |
| 3iyk_A | 526 | VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongu | 88.01 | |
| 4fla_A | 152 | Regulation of nuclear PRE-mRNA domain-containing 1 | 87.97 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 87.96 | |
| 3trt_A | 77 | Vimentin; cytoskeleton, intermediate filament, alp | 87.94 | |
| 3ni0_A | 99 | Bone marrow stromal antigen 2; coiled-coil, antivi | 87.93 | |
| 2dq0_A | 455 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 87.93 | |
| 3zx6_A | 341 | HAMP, methyl-accepting chemotaxis protein I; signa | 87.88 | |
| 1u5p_A | 216 | Spectrin alpha chain, brain; alpha spectrin, two r | 87.86 | |
| 1cii_A | 602 | Colicin IA; bacteriocin, ION channel formation, tr | 87.83 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 87.77 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 87.76 | |
| 1fxk_C | 133 | Protein (prefoldin); archaeal protein, chaperone; | 87.73 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 87.6 | |
| 2iak_A | 224 | Bullous pemphigoid antigen 1, isoform 5; triple he | 87.42 | |
| 1ez3_A | 127 | Syntaxin-1A; three helix bundle, endocytosis/exocy | 87.26 | |
| 2xnx_M | 146 | M protein, M1-BC1; cell adhesion, virulence factor | 87.23 | |
| 3qne_A | 485 | Seryl-tRNA synthetase, cytoplasmic; amino acid bio | 87.18 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 87.12 | |
| 1u4q_A | 322 | Spectrin alpha chain, brain; alpha spectrin, three | 87.12 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 87.12 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 86.83 | |
| 4h22_A | 103 | Leucine-rich repeat flightless-interacting protei; | 86.61 | |
| 2x3v_A | 337 | Syndapin I, protein kinase C and casein kinase sub | 86.55 | |
| 3fb2_A | 218 | Spectrin alpha chain, brain spectrin; non-erythroi | 86.52 | |
| 3edu_A | 218 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 86.45 | |
| 2b5u_A | 551 | Colicin E3; high resolution colicin E3, ribosome i | 86.43 | |
| 2x3v_A | 337 | Syndapin I, protein kinase C and casein kinase sub | 86.3 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 86.19 | |
| 1fxk_C | 133 | Protein (prefoldin); archaeal protein, chaperone; | 86.08 | |
| 3l4q_C | 170 | Phosphatidylinositol 3-kinase regulatory subunit b | 86.05 | |
| 1m1j_A | 491 | Fibrinogen alpha subunit; coiled coils, disulfide | 85.96 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 85.9 | |
| 3kbt_A | 326 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 85.88 | |
| 1cii_A | 602 | Colicin IA; bacteriocin, ION channel formation, tr | 85.75 | |
| 2c5k_T | 95 | Syntaxin TLG1, T-snare affecting A late golgi comp | 85.71 | |
| 2odv_A | 235 | Plectin 1, HD1; plakin domain, spectrin repeat, cy | 85.7 | |
| 2pms_C | 125 | Pneumococcal surface protein A (PSPA); lactoferrin | 85.65 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 85.58 | |
| 2ch7_A | 309 | Methyl-accepting chemotaxis protein; receptor, fou | 85.39 | |
| 2zdi_C | 151 | Prefoldin subunit alpha; chaperone, cytoplasm; 3.0 | 85.15 | |
| 1u4q_A | 322 | Spectrin alpha chain, brain; alpha spectrin, three | 85.1 | |
| 1quu_A | 250 | Human skeletal muscle alpha-actinin 2; triple-heli | 85.01 | |
| 3plt_A | 234 | Sphingolipid long chain base-responsive protein L; | 84.98 | |
| 3abh_A | 312 | Pacsin2, protein kinase C and casein kinase substr | 84.84 | |
| 1x8y_A | 86 | Lamin A/C; structural protein, intermediate filame | 84.76 | |
| 1pul_A | 125 | Hypothetical protein C32E8.3 in chromosome I; alph | 84.66 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 84.45 | |
| 2p2u_A | 171 | HOST-nuclease inhibitor protein GAM, putative; str | 84.45 | |
| 2v0o_A | 276 | FCHO2, FCH domain only protein 2; lipid-binding pr | 84.29 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 84.19 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 84.05 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 84.0 | |
| 2efl_A | 305 | Formin-binding protein 1; EFC domain, structural g | 83.79 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 83.54 | |
| 3s84_A | 273 | Apolipoprotein A-IV; four helix bundle, transport | 83.03 | |
| 3swf_A | 74 | CGMP-gated cation channel alpha-1; coiled-coil, as | 82.95 | |
| 3edv_A | 323 | Spectrin beta chain, brain 1; spectrin repeat, coi | 82.88 | |
| 1ik9_A | 213 | DNA repair protein XRCC4; DNA END joining, double- | 82.87 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 82.69 | |
| 3uux_B | 242 | Mitochondrial division protein 1; tetratricopeptid | 82.66 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 82.48 |
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
Probab=99.91 E-value=1.6e-24 Score=209.90 Aligned_cols=96 Identities=32% Similarity=0.542 Sum_probs=90.4
Q ss_pred CCCCCCCCCHHHHHHHHHHHHhhCCCCCCccCHHHHHHHHHhcCCCHHHHHHHHHhhCCCCCCCcCHHHHHHHHHHHHHH
Q 001211 394 SQVPWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDSMLSLREFCFALYLMERY 473 (1123)
Q Consensus 394 ~~~~Wp~ISpeDk~kY~~IF~slDkD~DG~ISG~Ear~~F~kSgLP~e~L~qIW~LADiDnDG~LdkdEF~IAMhLI~~~ 473 (1123)
...+| .|+++|+++|+++|+.+|+ ++|+|+++||+.+|+++||+.++|++||+|+|+|+||+|+++||++|||||+++
T Consensus 21 ~~~~W-~it~ee~~~y~~iF~~lD~-~dG~Isg~elr~~~~~sgLp~~~L~~Iw~laD~d~dG~Ld~~EF~~aM~Li~~~ 98 (121)
T 3fia_A 21 SLDTW-AITVEERAKHDQQFHSLKP-ISGFITGDQARNFFFQSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLK 98 (121)
T ss_dssp CTTTS-CCCHHHHHHHHHHHHHTCC-BTTBEEHHHHHHHHGGGCCCHHHHHHHHHHHCTTCSSEECHHHHHHHHHHHHHH
T ss_pred CCCCC-CCCHHHHHHHHHHHHHhCC-CCCeECHHHHHHHHHHcCCCHHHHHHHHHHHcCCCCCcCCHHHHHHHHHHHHHH
Confidence 34589 8999999999999999998 899999999999999999999999999999999999999999999999999999
Q ss_pred hcCCCCCCCCCCCccccc
Q 001211 474 REGRPLPAVLPRNVMFDE 491 (1123)
Q Consensus 474 ~~G~~LP~~LPpsLipps 491 (1123)
++|++||.+||++|+.+.
T Consensus 99 ~~G~~lP~~LP~~l~~~~ 116 (121)
T 3fia_A 99 LQGYQLPSALPPVMKQQP 116 (121)
T ss_dssp HTTCCCCSSCCGGGC---
T ss_pred HcCCCCCCCCCHHHHcCC
Confidence 999999999999999873
|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >1gk6_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, leucine zipper, fusion protein; 1.9A {Saccharomyces cerevisiae} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2xv5_A Lamin-A/C; structural protein, intermediate filaments, nuclear membrane LEFT-handed coiled coil, right-handed coiled coil; HET: MSE; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1d7m_A Cortexillin I; coiled-coil, coiled-coil trigger site, alpha helix, dimeriza contractIle protein; 2.70A {Dictyostelium discoideum} SCOP: h.1.10.1 | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3l4q_C Phosphatidylinositol 3-kinase regulatory subunit beta; PI3K, phosphoinositide-3-kinase, influenza virus, NS1; 2.30A {Bos taurus} PDB: 2v1y_B | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >1ez3_A Syntaxin-1A; three helix bundle, endocytosis/exocytosis complex; 1.90A {Rattus norvegicus} SCOP: a.47.2.1 PDB: 1br0_A 3lg7_A* | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >1gqe_A Release factor 2, RF2; protein synthesis, ribosome, macromolecular mimicry, translation; 1.81A {Escherichia coli} SCOP: e.38.1.1 PDB: 1mi6_A 1ml5_Z* | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C | Back alignment and structure |
|---|
| >1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B | Back alignment and structure |
|---|
| >3ajw_A Flagellar FLIJ protein; flagellum, type III secretion, coiled-coil, protein transpor; 2.10A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uul_A Utrophin; spectrin repeat, structural protein, cytoskeletal, helical bundle; 1.95A {Rattus norvegicus} PDB: 3uum_A | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1s94_A S-syntaxin; three helix bundle, structural plasticity, endocytosis-exocy complex; 3.34A {Loligo pealei} SCOP: a.47.2.1 | Back alignment and structure |
|---|
| >3thf_A Protein shroom; coiled-coil, anti-parallel, helical, RHO-kinase, actin-bindi protein binding, cytoskeleton regulator; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3uun_A Dystrophin; triple helical, cell structure and stability, cytoskeletal, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >3plt_A Sphingolipid long chain base-responsive protein L; eisosomes, LSP1, PIL1, BAR domain, plasma membrane, SELF-ASS phosphoprotein; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3ghg_B Fibrinogen beta chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_B* 1deq_B 2a45_H* | Back alignment and structure |
|---|
| >1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A | Back alignment and structure |
|---|
| >2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A | Back alignment and structure |
|---|
| >3etw_A Adhesin A; antiparallel helix-loop-helix, leucine chain, cell adhesin, cell adhesion; 2.00A {Fusobacterium nucleatum} PDB: 3ety_A 3etx_A 3etz_A 2gl2_A | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} SCOP: a.7.1.0 | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >1d7m_A Cortexillin I; coiled-coil, coiled-coil trigger site, alpha helix, dimeriza contractIle protein; 2.70A {Dictyostelium discoideum} SCOP: h.1.10.1 | Back alignment and structure |
|---|
| >4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >3ghg_B Fibrinogen beta chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_B* 1deq_B 2a45_H* | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A | Back alignment and structure |
|---|
| >2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A | Back alignment and structure |
|---|
| >2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M | Back alignment and structure |
|---|
| >3iyk_A VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongue virus} | Back alignment and structure |
|---|
| >4fla_A Regulation of nuclear PRE-mRNA domain-containing 1B; structural genomics consortium, SGC, transcription; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* | Back alignment and structure |
|---|
| >3ni0_A Bone marrow stromal antigen 2; coiled-coil, antiviral defense, immune system, GPI anchor; 1.60A {Mus musculus} | Back alignment and structure |
|---|
| >2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A | Back alignment and structure |
|---|
| >3zx6_A HAMP, methyl-accepting chemotaxis protein I; signaling, HAMP domain, TSR receptor, fusion; 2.65A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C | Back alignment and structure |
|---|
| >1fxk_C Protein (prefoldin); archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ez3_A Syntaxin-1A; three helix bundle, endocytosis/exocytosis complex; 1.90A {Rattus norvegicus} SCOP: a.47.2.1 PDB: 1br0_A 3lg7_A* | Back alignment and structure |
|---|
| >2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >2x3v_A Syndapin I, protein kinase C and casein kinase substrate in N protein 1; BAR, N-WAsp, dynamin, pacsin 1, endocytosis; 2.45A {Mus musculus} PDB: 2x3w_A 2x3x_A | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A | Back alignment and structure |
|---|
| >2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* | Back alignment and structure |
|---|
| >2x3v_A Syndapin I, protein kinase C and casein kinase substrate in N protein 1; BAR, N-WAsp, dynamin, pacsin 1, endocytosis; 2.45A {Mus musculus} PDB: 2x3w_A 2x3x_A | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >1fxk_C Protein (prefoldin); archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 | Back alignment and structure |
|---|
| >3l4q_C Phosphatidylinositol 3-kinase regulatory subunit beta; PI3K, phosphoinositide-3-kinase, influenza virus, NS1; 2.30A {Bos taurus} PDB: 2v1y_B | Back alignment and structure |
|---|
| >1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A | Back alignment and structure |
|---|
| >1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 | Back alignment and structure |
|---|
| >2c5k_T Syntaxin TLG1, T-snare affecting A late golgi compartment protein 1; protein transport/complex, snare, VFT complex, protein transport, phosphorylation; 2.05A {Saccharomyces cerevisiae} PDB: 2c5j_A 2c5i_T | Back alignment and structure |
|---|
| >2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A | Back alignment and structure |
|---|
| >2pms_C Pneumococcal surface protein A (PSPA); lactoferrin, protein-protein metal transport, hydrolase; HET: NAG; 2.91A {Streptococcus pneumoniae} SCOP: h.4.19.1 | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ch7_A Methyl-accepting chemotaxis protein; receptor, four-helix bundle, signal transduction, methyl-accepting receptor; 2.5A {Thermotoga maritima} SCOP: h.4.5.1 PDB: 2ch7_B | Back alignment and structure |
|---|
| >2zdi_C Prefoldin subunit alpha; chaperone, cytoplasm; 3.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3plt_A Sphingolipid long chain base-responsive protein L; eisosomes, LSP1, PIL1, BAR domain, plasma membrane, SELF-ASS phosphoprotein; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3abh_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.00A {Homo sapiens} PDB: 3q0k_A 3lll_A 3hah_A 3qni_A 3hai_A 3q84_A | Back alignment and structure |
|---|
| >1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A | Back alignment and structure |
|---|
| >1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >2p2u_A HOST-nuclease inhibitor protein GAM, putative; structural genomics, unknown function, PSI-2, protein structure initiative; 2.75A {Desulfovibrio vulgaris} SCOP: h.4.18.1 | Back alignment and structure |
|---|
| >2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1ik9_A DNA repair protein XRCC4; DNA END joining, double-strand break repair, V(D)J recombination, protein-protein complex, coiled coil; HET: DNA; 2.30A {Homo sapiens} SCOP: b.59.1.1 h.1.11.1 PDB: 3ii6_A* 1fu1_A* 3rwr_A* | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >3uux_B Mitochondrial division protein 1; tetratricopeptide repeat, mitochondrial fission, mitochondri cytoplasm, apoptosis; 3.90A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1123 | ||||
| d2jxca1 | 95 | a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ | 8e-20 | |
| d2jxca1 | 95 | a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ | 4e-13 | |
| d1fi6a_ | 92 | a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: | 5e-19 | |
| d1fi6a_ | 92 | a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: | 4e-12 | |
| d1iq3a_ | 110 | a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 | 2e-18 | |
| d1iq3a_ | 110 | a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 | 3e-09 | |
| d1c07a_ | 95 | a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: | 7e-18 | |
| d1c07a_ | 95 | a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: | 6e-13 | |
| d1qjta_ | 99 | a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: | 3e-17 | |
| d1qjta_ | 99 | a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: | 2e-16 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 7e-07 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 7e-05 | |
| d1s6ja_ | 87 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 6e-06 | |
| d1s6ja_ | 87 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 0.002 | |
| d2pq3a1 | 73 | a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T | 2e-05 | |
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 4e-05 | |
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 1e-04 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 5e-05 | |
| d1avsa_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 6e-05 | |
| d1tiza_ | 67 | a.39.1.5 (A:) Calmodulin-related protein T21P5.17 | 8e-05 | |
| d1tiza_ | 67 | a.39.1.5 (A:) Calmodulin-related protein T21P5.17 | 0.003 | |
| d1fi5a_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), | 1e-04 | |
| d1fi5a_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), | 4e-04 | |
| d1c7va_ | 68 | a.39.1.5 (A:) Calcium vector protein {Amphioxus (B | 2e-04 | |
| d1c7va_ | 68 | a.39.1.5 (A:) Calcium vector protein {Amphioxus (B | 2e-04 | |
| d1f54a_ | 77 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 2e-04 | |
| d1rwya_ | 109 | a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta | 2e-04 | |
| d1rwya_ | 109 | a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta | 0.002 | |
| d1jc2a_ | 75 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 3e-04 | |
| d1jc2a_ | 75 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 3e-04 | |
| d1rroa_ | 108 | a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) | 5e-04 | |
| d1rroa_ | 108 | a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) | 0.004 | |
| d1topa_ | 162 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 7e-04 | |
| d1topa_ | 162 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 0.002 | |
| d5pala_ | 109 | a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis | 0.002 | |
| d1wrka1 | 82 | a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) | 0.002 | |
| d1exra_ | 146 | a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr | 0.002 | |
| d1pvaa_ | 109 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 0.002 | |
| d1nyaa_ | 176 | a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth | 0.003 | |
| d2fcea1 | 61 | a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ | 0.004 | |
| d1xk4a1 | 87 | a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa | 0.004 | |
| d1fw4a_ | 65 | a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: | 0.004 | |
| d1dtla_ | 156 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 0.004 |
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Eps15 homology domain (EH domain) domain: Eps15 species: Human (Homo sapiens) [TaxId: 9606]
Score = 83.1 bits (205), Expect = 8e-20
Identities = 31/88 (35%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
Query: 397 PWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDS 456
PW +KP D KY +F + +G ++G++ + + ++ +LP ++L +VW+LSD D D
Sbjct: 1 PWA-VKPEDKAKYDAIFDSLS-PVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDG 58
Query: 457 MLSLREFCFALYLMERYREGRPLPAVLP 484
ML EF A++L+ E P+P LP
Sbjct: 59 MLDRDEFAVAMFLVYCALEKEPVPMSLP 86
|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1123 | |||
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 99.91 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.91 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.9 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 99.84 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 99.77 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 99.75 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.75 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.74 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.74 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 99.0 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 98.95 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 98.94 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.85 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 98.85 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 98.8 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 98.76 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 98.75 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 98.73 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 98.71 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 98.71 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 98.68 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.68 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.67 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 98.67 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 98.66 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 98.66 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.62 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 98.61 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 98.61 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 98.61 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 98.61 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 98.58 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 98.58 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 98.55 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 98.55 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 98.55 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 98.54 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 98.54 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 98.54 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 98.54 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 98.53 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 98.53 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 98.52 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 98.52 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 98.52 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 98.5 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 98.5 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 98.41 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 98.41 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 98.4 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 98.38 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 98.36 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 98.34 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 98.34 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 98.32 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 98.32 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 98.29 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 98.29 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 98.29 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 98.29 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.28 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 98.28 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 98.28 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 98.25 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.25 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 98.24 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 98.24 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 98.23 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 98.22 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 98.21 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 98.21 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 98.21 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 98.21 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 98.2 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.2 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 98.2 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 98.18 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 98.18 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 98.16 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 98.16 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 98.14 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 98.13 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 98.13 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 98.13 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 98.12 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 98.12 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 98.1 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.1 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 98.09 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 98.09 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 98.08 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 98.06 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 98.06 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 98.04 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 98.02 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 98.02 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 98.0 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 97.99 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 97.97 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 97.97 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 97.96 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 97.94 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 97.94 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 97.93 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 97.93 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 97.93 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 97.92 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 97.92 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 97.91 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 97.91 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 97.91 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 97.89 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 97.87 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 97.87 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 97.87 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 97.85 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 97.83 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 97.82 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 97.81 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 97.79 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 97.77 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 97.77 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 97.77 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 97.76 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 97.76 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 97.73 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 97.71 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 97.67 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 97.66 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 97.66 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 97.65 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 97.64 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 97.64 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 97.61 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 97.61 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 97.54 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 97.54 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 97.52 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 97.51 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 97.34 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 97.23 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 97.21 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 97.18 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 97.18 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 97.13 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 96.95 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 96.71 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 96.53 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 96.51 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 96.25 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 96.09 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 96.01 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 95.98 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 95.86 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 95.51 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 95.36 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 95.29 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 95.21 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 94.54 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 94.42 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 93.93 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 93.36 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 93.26 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 93.21 | |
| d2efla1 | 288 | Formin-binding protein 1, FNBP1 {Human (Homo sapie | 93.08 | |
| d1fxkc_ | 133 | Prefoldin alpha subunit {Archaeon Methanobacterium | 93.07 | |
| d1ez3a_ | 124 | Syntaxin 1A N-terminal domain {Rat (Rattus norvegi | 93.03 | |
| d1owaa_ | 156 | Spectrin alpha chain {Human (Homo sapiens) [TaxId: | 92.98 | |
| d2efla1 | 288 | Formin-binding protein 1, FNBP1 {Human (Homo sapie | 92.53 | |
| d1gqea_ | 362 | Polypeptide chain release factor 2 (RF2) {Escheric | 92.07 | |
| d2efka1 | 279 | CDC42-interacting protein 4, CIP4 {Human (Homo sap | 90.89 | |
| d2efka1 | 279 | CDC42-interacting protein 4, CIP4 {Human (Homo sap | 90.02 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 89.84 | |
| d1f5na1 | 300 | Interferon-induced guanylate-binding protein 1 (GB | 89.26 | |
| d1s35a2 | 105 | Spectrin beta chain {Human (Homo sapiens) [TaxId: | 89.02 | |
| d1u5pa1 | 110 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 88.43 | |
| d1fxkc_ | 133 | Prefoldin alpha subunit {Archaeon Methanobacterium | 88.39 | |
| d1quua1 | 124 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 87.63 | |
| d2spca_ | 107 | Spectrin alpha chain {Drosophila sp. [TaxId: 7242] | 87.13 | |
| d1u5pa2 | 101 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 84.55 | |
| d1f5na1 | 300 | Interferon-induced guanylate-binding protein 1 (GB | 84.41 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 83.19 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 80.79 | |
| d1wlma1 | 138 | Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 | 80.66 | |
| d1ez3a_ | 124 | Syntaxin 1A N-terminal domain {Rat (Rattus norvegi | 80.52 | |
| d2azea1 | 148 | Transcription factor DP-1 {Human (Homo sapiens) [T | 80.45 |
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Eps15 homology domain (EH domain) domain: Pob1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91 E-value=1.5e-25 Score=210.61 Aligned_cols=103 Identities=30% Similarity=0.565 Sum_probs=98.8
Q ss_pred CCCCCCCCCCCCCCCCHHHHHHHHHHHHhhCCCCCCccCHHHHHHHHHhcCCCHHHHHHHHHhhCCCCCCCcCHHHHHHH
Q 001211 387 GNSTPDNSQVPWPKMKPSDIQKYSKVFMEVDTDRDGRITGEQARNLFMSWRLPREVLKQVWDLSDQDSDSMLSLREFCFA 466 (1123)
Q Consensus 387 ~~~~s~~~~~~Wp~ISpeDk~kY~~IF~slDkD~DG~ISG~Ear~~F~kSgLP~e~L~qIW~LADiDnDG~LdkdEF~IA 466 (1123)
-.+++..+..+| +||++|+.+|+++|..+|+|++|+|++++++.+|+++||+.++|++||+++|.|++|+|+++|||+|
T Consensus 3 ~~~~~~~~~~~~-~lt~ee~~~y~~lF~~~D~d~~G~Is~~e~~~~l~~s~L~~~~L~~Iw~l~D~d~dG~l~~~EF~~a 81 (110)
T d1iq3a_ 3 LQDNSSYPDEPW-RITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAA 81 (110)
T ss_dssp SCCCCCCCCSSC-CCSSSSHHHHHHHHHHHCCSSSSEEEHHHHHHHCCSSSCSSCCHHHHHHHHCSSSCSEEEHHHHHHH
T ss_pred CCCCCCCCCCCC-ccCHHHHHHHHHHHHHhCCCcccchhHHHHHHHHHhhccchHHHHHHHHHhccCCCCeECHHHHHHH
Confidence 345567788899 9999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhcCCCCCCCCCCCcccc
Q 001211 467 LYLMERYREGRPLPAVLPRNVMFD 490 (1123)
Q Consensus 467 MhLI~~~~~G~~LP~~LPpsLipp 490 (1123)
||||.++++|++||..||++|+|.
T Consensus 82 m~Li~~~~~G~~lP~~LP~~l~p~ 105 (110)
T d1iq3a_ 82 FHLIVARKNGYPLPEGLPPTLQPE 105 (110)
T ss_dssp HHHHHHHHHTCCCCCCSSCCSCSS
T ss_pred HHHHHHHHcCCCCCcccCcccCcc
Confidence 999999999999999999999997
|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ez3a_ a.47.2.1 (A:) Syntaxin 1A N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ez3a_ a.47.2.1 (A:) Syntaxin 1A N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2azea1 e.63.1.1 (A:199-346) Transcription factor DP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|